KEGG   Acinonyx jubatus (cheetah): 106982355Help
Entry
106982355         CDS       T04657                                 

Gene name
PIN4
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 isoform X1
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aju03110]
    106982355 (PIN4)
Enzymes [BR:aju01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     106982355 (PIN4)
Chaperones and folding catalysts [BR:aju03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    106982355 (PIN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 106982355
NCBI-ProteinID: XP_026909376
Position
Unknown
AA seq 163 aa AA seqDB search
MPPKGKSRSGKGGKGGAASGSDSSDKKAQGPKGGGNAVKHPTQETAPLHVASKRILALSG
KKNEFSVAVHEVRHILCEKHGKIMEAMEKLKSGMRFNEVAIQYSEDKARQGGDLGWMTRG
TMVGPFQEAAFALPISGLDKPVFTDPPVKTKFGYHIIMVEGRK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaagggaaaaagccgctccgggaaaggggggaaagggggagcagcctctggg
agtgacagttctgacaagaaggctcagggtcccaaaggtggtggcaatgcagtaaagcac
ccaacacaagagactgctccgctgcacgtggcttcaaagaggattcttgctctttctgga
aaaaaaaatgagttcagtgtggctgtgcatgaggtcagacacattctgtgtgaaaaacat
gggaaaatcatggaagccatggaaaagttgaagtctggaatgagattcaatgaagtggcc
atacagtatagtgaagataaagccaggcaagggggtgacttgggttggatgaccagaggt
accatggtgggaccatttcaagaagcagcatttgccttgcccataagtgggctggataag
cctgtgtttacagaccctccagttaagacaaaatttggatatcatattattatggttgaa
gggagaaaataa

DBGET integrated database retrieval system