KEGG   Acinonyx jubatus (cheetah): 106983925Help
Entry
106983925         CDS       T04657                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis protein 6
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aju04131]
    106983925 (DOCK6)
Membrane trafficking [BR:aju04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106983925 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 106983925
NCBI-ProteinID: XP_026905999
Position
Unknown
AA seq 2173 aa AA seqDB search
MPSPLLSSAQQPCQVPSDPWILKPRFSWSGAWFFPSTAWIFVSEKGFIGPKWSSPGPTAQ
VFVSPVAPFCPRRTVAAEVRKQVSRERSGSPHSSRRSSGSLGVPLTEVIEPLDFEDVLLS
RPPDAEPGPLRDLAEFPADDLELLLQPRECRTTEPGTPEDGKLDAQVRAAVEMYTEDWII
AHRRYQHLSAAFSPITTETQRERQKGLTRQVFEQDTSGDERSGPEDSDDPRHSSGSLDDT
PRSSGASGIFDLRNLAADSLLPSLLERTAPEDVDRRNEALRRQHRPRALLALYPAPDEDE
AVERCSRPEPPREHFGQRILVKCLSLKFEIEIEPIFGILALYDVREKKKISENFYFDLNS
DSVKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQGDISECCEPYMVMK
EVDTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSAGQTDRDSDSEGERR
PAWTDRRRRGPQDRTSGGDDTCSFSSFRPATLTVTNFFKQEAERLSDEDLFKFLADMRRP
SSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHVKPYPDPRGRPTKEILEFPAREVYA
PHTSYRNLLYVYPHCLNFSSRQGSVRNLAVRVQYMAGEDPSQALPVIFGKSSCSEFTREA
FTPVVYHNKSPEFYEEFKLRLPACVTENHHLLFTFYHVSCQPRPGTALETPVGFTWIPLL
QHGRLRTGPFCLPVSVDQLPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAVSSVHPQDP
HLDKFFTLVHVLEEGAFPFRLKDTVLSEGTVEQELRASLAALRLASPQPLVAFSHHVLDK
LVHLVVRPPIIGGQIVNLGRGAFEAMAHVVSLVHRSLEAAQDARGHCPLLAAYVHYAFQL
PGTEPNFPSGAPPVTVQAATLARGPGRPASLYLARSKSISSSNPDLAVAPGSVDDEVSRI
LASKGIDRSHSWVNSAYAPGGSKAVLRRAPPYCGADPRQAIDCSSSRTSFYLEGSSLAPP
ATQPRPTVQKLLHEELALQWVVSGSAVRETVLQHAWFFFQLMVKSMALHLLLGQRLDTPR
KLRFPGRFLDDIAALVGSVGLEVITRVYKDAELAERLNASLAFFLSDLLSLADRGFVFSL
VRAHYKQVATRLQSAPNPALLLTLRMDFTRILCSHEHYVTLNLPCCPLSPPASPSPSVSS
TTSQSSTFSSQAPDPKVTSMFELSGPFRQQHFLAGLLLTELALALEPEAEGASLLHKKAI
SAVHSLLCGHDADPRYTEAAVKARVAELYLPLLSLARDTLPRLHDFAEGPGQRSRLASML
DSDTEGEGDIGGTINPSVAMAIAGGPLAPGSRASISQGPVAASRSGCPLSAESSRTLLVC
VLWVLKNAEPALLQRWAADLALPQLGRLLDLLYLCLAAFEYKGKKAFERINSLTFKKSLD
MKARLEEAILGTIGARQEMVRRSRERSPFGNQENVRWRKSITHWRQTSDRVDKTKDEMEH
EALVDGNLATEASLVVLDTLEIIVQTVMLSEARESVLGAVLKVVLYSLGSAQSALFLQHG
LATQRALVSKFPELLFEEDTELCADLCLRLLRHCGSRISTIRTHASASLYLLMRQNFEIG
NNFARVKMQVTMSLSSLVGTTQSFSEEHLRRSLKTILTYAEEDVGLRDSTFSEQVQDLMF
NLHMILTDTVKMKEHQEDPEMLIDLMYRIARGYQGSPDLRLTWLQNMAGKHAELGNHAEA
AQCMVHAAALVAEYLALLEDSRYLPVGCVSFQNISSNVLEESAISDDILSPDEEGFCSGK
HFTELGLMGLLEQAAAYFTMGGLYEAVNEVYKTLIPILEAHRDYKKLAAVHGKLQEAFTK
IMHQSSGWETQRVFGTYFRVGFYGARFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERF
GEDVVEIVKDSNPVDKTKLDPQKAYIQITYVEPHFDTYELKDRVTYFDRNYGLRTFLFCT
PFTPDGRAHGDLPEQHKRKTLLSTDHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTR
ELAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLAEIPEDPKLFRHHNKLRLCF
KDFCKKCEDALRKNKALIGPDQKEYHRELERNYCRLREALQPLLTQRLPQLLAPPTAGLR
NSLNRASFRKADL
NT seq 6522 nt NT seq  +upstreamnt  +downstreamnt
atgccgagccccctgctcagctctgcacagcagccttgtcaggtcccttcagatccgtgg
attctgaagcctagattctcctggtccggggcctggtttttcccttccacagcctggatt
ttcgtctcggagaagggatttattggcccgaagtggagttctccgggccccactgcccaa
gtgttcgtgtccccagtggcacccttctgtccccgcaggacggtggctgcggaggtacgg
aagcaggtgtcccgggagcgcagtggctccccccactccagcagacgcagcagcggctcc
ctgggggtcccactgactgaagtcattgagcccctggacttcgaggatgtgctcctgagc
cggcctccagatgccgaacccgggcccctccgggacctggccgagtttccggctgatgac
ctcgagctgctgttacagccccgggaatgccggaccacggagcccgggacccccgaggat
ggaaagctggatgcccaggtgagggccgcggtggagatgtacacggaggattggatcatc
gcccacaggaggtaccagcatctgagtgcagcgttcagccccatcaccacagagacgcag
cgagagcggcaaaagggcctcacccgccaggtctttgagcaggacacttctggggatgag
aggtccggcccagaggactcggatgacccccggcactcctcgggctccctggatgacacc
cctcgaagcagtggggcctctggcatcttcgacctgaggaacttggcagctgactcattg
ctgccctcgctgctggaacgcacagcccctgaagatgtggaccggcggaacgaggccttg
cggcgacagcaccggccccgcgccctgctggccctctacccagcacccgatgaggatgag
gccgtggaacgctgcagccgccccgagccgccccgtgagcacttcggacagaggatcttg
gtcaagtgtctgtcgctgaagtttgaaatcgaaattgagcccatctttggcatcttggcc
ctgtatgatgtgcgggagaaaaagaagatctcagaaaacttctactttgacctgaactcg
gactctgtgaaggggctactgcgggctcatggcacccaccctgccatctccacgctggcc
cgctctgccatcttctccgtgacctacccctcacctgatatcttcctggtcatcaagctg
gagaaggtgttgcagcagggggacatcagcgagtgttgcgagccatacatggtgatgaag
gaggtggacacggccaagaacaaagagaagctggagaagctgcgcctggcagccgagcag
ttctgcacccgcctgggccgctaccgcatgcccttcgcctggaccgccgttcacctggcc
aacatcgtgagcagcgccggccagacggaccgcgactcggactccgagggagagcgccga
cctgcctggactgaccgccgccgtcgggggccccaggatcggacgagtggtggggatgac
acctgcagcttctccagcttccgcccagccacgctaactgtcaccaacttctttaagcag
gaagctgagcggctcagcgatgaggacctcttcaagttcctggctgacatgcgacgccca
tcctctctactgcggcgcctgcggcccgtgactgcccagctcaagatcgacatctccccg
gctcccgagaacccgcacttctgcctctcaccggagctgcttcatgtcaagccctaccca
gaccccaggggccggcccaccaaggagatcttggagttcccagcccgtgaggtctacgcc
ccccataccagctacaggaacctgctgtacgtgtacccgcactgcctcaacttcagcagc
cgccagggctccgtgcgcaacctcgccgtgcgagtgcagtatatggcgggcgaggacccc
agccaggccctgccggtcatctttggcaagtcgagctgcagcgaattcacccgcgaggcc
ttcacgccggtggtctaccacaacaagtccccagagttctacgaggagttcaagctgcgc
cttccggcctgcgtgaccgagaaccaccacctgctgttcaccttctaccacgtcagctgc
cagccccgaccgggcaccgcactggagacccccgtgggctttacttggatcccgctgctg
cagcacggccgcctgaggaccggccccttctgcctccctgtgtccgtggaccagctcccg
cccagctactccgtgctcactccagacgtggcgctgccgggcatgcgctgggtggacggc
cacaagggcgtgttcagcgtggagctcactgctgtgtcctctgtgcacccccaggaccct
cacctggacaagttcttcactctggtgcacgtcctggaggaaggggccttcccgttccgc
ctcaaggacaccgtgctgagtgaggggaccgtggagcaggagctgcgggccagcctagcc
gcactgcgcctcgccagcccccagccacttgttgctttctcccaccacgtgctggacaag
ctcgtgcatctggtcgtgcggcctccaatcattggcggccagatcgtgaacctaggtcgt
ggggccttcgaagcaatggcccatgtggtcagccttgtccaccggagcctagaggctgcc
caggatgcccgtggtcactgcccgctgctggctgcctatgtccactacgccttccaactg
cccggcaccgagcccaacttcccaagtggggcccctccagtgacggtgcaggctgccacg
ctggcccgtggccctggccgccccgctagcctctacctggctcgctctaagagcatcagc
agcagcaacccggacctggccgtggcccctggctctgtggacgacgaggtctcccgcatc
ctggccagcaagggtatcgaccgctcacactcctgggtgaattctgcttatgctccagga
ggcagcaaggctgtgctgcgacgggcacccccttactgcggggccgaccccagacaggcc
atcgactgcagctctagccgaacttctttctacctcgagggctcctccttggccccaccg
gccacccagccgagacccactgtgcagaagctgcttcacgaggagctggccctgcagtgg
gtggtcagcggcagcgccgtgcgagagacggtcctgcaacatgcctggttcttcttccag
ctcatggtgaaaagcatggccctgcacctgcttctgggccagcggctggacacgccccgc
aagcttcgcttccctgggcgcttcctggacgacatcgcggcccttgtgggctctgtgggc
ctggaagtcatcacccgggtgtacaaggacgcggagctggccgagcgcctcaacgccagc
ctggccttcttcctcagcgatctgctgtccctggcggaccgaggcttcgtcttcagcctg
gtccgagcccactacaagcaggtggccacgcggctgcagtcggcccccaacccagcattg
ctgctgaccctgcgcatggacttcacccgcatcctgtgcagccacgagcactacgtgacc
ctcaacctcccctgctgccccctgtcgcctccggcctcgccctcgccctccgtatcctcc
accacctcccagagctccaccttctccagccaggccccagaccccaaggtgaccagcatg
ttcgagctgagcgggccgttccggcagcagcactttctggctgggctcctgctgacggag
ctggcgctggccctggaacctgaggccgagggggcatccctgctgcacaagaaggccatc
agtgccgtccacagtctgctctgtggccatgacgctgacccccgctacaccgaggctgcc
gtgaaggcccgtgtggccgagctgtacctacccctgctgtcacttgcacgggacacgctg
ccacggctgcatgattttgctgagggcccaggtcaacggtcaagactggcctcgatgctc
gactcagacacagaaggggaaggggacatcggaggcaccatcaacccctcagtggccatg
gccatcgctggtggccccctagcccctggctcccgggctagcatctcccagggcccagtg
gcagcttctcgctcaggctgccccctctctgctgagtccagccggaccttactggtgtgt
gtgctgtgggtcctgaagaatgctgagccagccctcctgcagcgctgggctgctgacctt
gccctccctcagctgggtcgtctcttggacttgctgtacctttgcctcgctgcctttgag
tacaaggggaaaaaggcctttgagcgcatcaacagtctcacgttcaagaagtcactggac
atgaaggctcgtctggaggaagccatcttgggcactattggagcacgacaggagatggtc
cggcggagtcgtgagaggagtccctttgggaaccaggagaacgtccgctggcggaagagc
atcacacactggagacagacctcagaccgtgtggacaagaccaaggatgaaatggaacac
gaggccttggtggacgggaacctggcgaccgaggcaagcctggtggttctggacacactg
gagatcatcgtgcagacggtcatgctgtcagaggcccgggagagcgtcttaggcgcagtg
cttaaagttgtgctctacagtctgggcagtgcccagagtgccctcttcttgcagcatggc
ctggccacacagcgagccctggtgtccaagttcccagagctgctgttcgaggaggacaca
gagctgtgtgccgatctctgcttgaggctcctgcgacactgcggcagccgcatcagcacc
atccgcacgcacgccagcgcctcactctacctcctcatgcgccagaatttcgagatcggc
aacaactttgcccgcgtgaagatgcaagtgaccatgtcgctctcgtccctggtggggacg
acacagagcttcagtgaagagcacctgagacggtcactgaagaccatcctcacctatgcg
gaggaggacgtagggctgcgggacagcaccttctcggagcaggtccaggacctgatgttc
aacctgcacatgatcctgacggacacggtgaagatgaaggagcatcaggaggacccggag
atgctcatcgatctcatgtacaggattgcccgcggctaccagggctcccccgacctgcgg
ctcacgtggttgcagaacatggcagggaaacatgcagagctgggcaaccacgcggaggcc
gcccagtgcatggtgcacgcagccgccctggtggccgagtacctcgccctgctggaggac
agccgctacctgcccgtgggctgcgtctcgttccagaacatctcatccaacgtgctagag
gaatcggccatctccgacgacatcctgtcgcctgacgaggagggcttctgttccgggaag
cacttcacggagctggggctgatgggactgctggagcaggcggcagcctacttcaccatg
ggcgggctctatgaggcagtgaacgaggtctacaagaccctcatccccatcctggaagcc
caccgagactacaagaagctggctgccgtgcacggcaaactgcaggaggccttcaccaag
atcatgcaccagagctctggctgggagacgcagcgtgtgttcgggacgtatttccgtgtg
ggcttctatggtgcccgcttcggcgacctggacgagcaggagtttgtgtataaagagccg
tccatcacgaagctggctgagatttcacaccggctggaggagttctacacggagaggttt
ggggaggacgtggtcgagattgtcaaagattcgaaccccgtggacaagaccaagcttgac
ccacagaaggcttacatccagatcacttacgtggaaccgcacttcgacacctacgagctc
aaggaccgggtgacttacttcgaccgcaactacgggctgcgcaccttcctgttctgcacg
cccttcacgcctgacgggcgcgcgcatggggacctgcctgagcagcacaagcgcaagact
ctgctcagcacagaccacgccttcccctacatcaagacccggatccgcgtgtgccaccgc
gaggagacagtgctgacacccgtggaggtggccatcgaagacatgcagaagaagacacgg
gagctggccttcgccaccgagcaggacccgcccgacgccaagatgctacagatggtgctt
cagggctctgtggggcccactgtgaaccaggggcccctggaggtggcccaggtgttcttg
gcggagatcccggaagaccccaaactcttcaggcatcataacaagctgcggctctgtttc
aaggacttctgcaagaagtgtgaggacgccctgcggaagaacaaggccctgatagggcca
gaccagaaggagtaccaccgagagctggagcggaactactgtcgcctgcgggaggctctg
cagcccctgctcacccagcgcctgccccagctgctggcgcctcccacggcaggcctcagg
aactccttgaacagagcaagtttccggaaggccgacctctga

DBGET integrated database retrieval system