KEGG   Acinonyx jubatus (cheetah): 106984920Help
Entry
106984920         CDS       T04657                                 

Gene name
PGD
Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00030  Pentose phosphate pathway
aju00480  Glutathione metabolism
aju01100  Metabolic pathways
aju01200  Carbon metabolism
Module
aju_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
aju_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106984920 (PGD)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106984920 (PGD)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     106984920 (PGD)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     106984920 (PGD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored GFP Sas6_CC DNA_pol3_beta
Motif
Other DBs
NCBI-GeneID: 106984920
NCBI-ProteinID: XP_014938619
Position
Unknown
AA seq 483 aa AA seqDB search
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGARSLEE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRTLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGDKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLDMGHDEMAKAFEEWNKTELDSFLIEITANIL
KFQDSDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERVQA
SQKLKGPQKIQFEGDKKSFLEDIQKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPHLQNLLLDDFFKSAVENCQDSWRRTVSTGVRAGIPM
PCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLANPGRFVHTNWTGHGGSVSSSS
YNA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagctgatatagcactgattggactggcagtcatgggccagaacttaattttg
aacatgaatgaccatggcttcgtggtttgtgcttttaataggacggtctccaaagtggac
gatttcttggccaacgaggcaaagggaaccaaggtggttggtgcacgctccttggaggag
atggtctccaagctgaagaaacctcggcgcatcatactgctggtgaaggctggccaagcc
gttgatgatttcattgaaaaactggtaccattgttggacactggtgacatcatcattgat
ggaggaaattctgaatacagggataccacaagacgatgtcgaaccctcaaggccaaggga
atcctgtttgtggggagcggagtcagtggcggagaggaaggggcccgctatggcccctca
cttatgccaggaggtgacaaagaagcctggccccacatcaagacaatcttccaaggcatc
gctgcaaaagtaggaactggggaaccgtgctgtgactgggtgggagatgaaggagcggga
cacttcgtgaagatggtgcacaacgggatagagtacggggacatgcagctcatctgtgag
gcctaccacctgatgaaagatgtgctggacatggggcacgacgagatggcgaaggcattt
gaggaatggaataagaccgagctcgactcgttcctgattgaaatcacggccaacatcctc
aagttccaagacagcgacggcaagcacctgctgccgaagatcagggacagcgcggggcag
aagggcacagggaagtggactgccatctcagccctggagtacggcgttcctgtcaccctc
atcggagaggcagtttttgctcggtgcttatcgtctctgaaggacgagagggttcaagcc
agccaaaagctgaagggtccccaaaagatccagtttgaaggtgataagaaatcattcctg
gaggacattcagaaggccctgtatgcttccaagatcatctcgtacgcgcaaggctttatg
ctgctgagacaagccgccacggaattcggctggaccctcaactacggtggcatcgccctg
atgtggagggggggctgcatcatcaggagcgtgttcctaggaaagataaaagacgcattc
gatcggaacccacaccttcagaatctactactggatgacttttttaagtctgctgttgaa
aactgccaggactcctggcggcggacggtgagcaccggtgtccgggcgggcatccccatg
ccctgcttcaccaccgccctctccttctacgacggctacagacacgagatgctgcccgcc
aaccttatccaggctcagcgggattacttcggggctcacacttacgaactcttagccaac
cccggacggtttgtccacaccaattggacaggccacggtggcagcgtgtcgtcctcttcc
tacaatgcctga

DBGET integrated database retrieval system