KEGG   Acinonyx jubatus (cheetah): 106985090Help
Entry
106985090         CDS       T04657                                 

Gene name
MGAT2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00510  N-Glycan biosynthesis
aju00513  Various types of N-glycan biosynthesis
aju01100  Metabolic pathways
Module
aju_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    106985090 (MGAT2)
   00513 Various types of N-glycan biosynthesis
    106985090 (MGAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aju01003]
    106985090 (MGAT2)
Enzymes [BR:aju01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     106985090 (MGAT2)
Glycosyltransferases [BR:aju01003]
 Glycan extension
  N-Glycan
   106985090 (MGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 106985090
NCBI-ProteinID: XP_026921468
Position
Unknown
AA seq 446 aa AA seqDB search
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHSAV
SVGIRRVSNESAAPLVPAAPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGSWTPRELVL
VVQVHNRPDYLRLLLDSLRKAQGIDSVLVIFSHDFWSTEINQLIAGVDFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLEKNAALKMGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKVLRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYTASRSF
HGIADKVDVKTWKSTEHNMGLALTRDAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQVPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYLFPDTLTISEKFVAA
ISPPRKNGGWGDIRDHELCKSYRRLQ
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggttccgcatctacaagcggaaggtgctgatcctgacgctcgtggtggccgcctgc
ggcttcgtcctctggagcagcaatgggcgacaaaggaaaaacgaggccctcgccccgccg
ctgctggacgccgagcccgcgcgaggtgcgggcggccggggcggggaccattcggctgtg
tccgtgggcatccgccgggtctccaacgagtcggcggctccgctggtccccgcggccccg
cagcccgaggcggacaacctgacgctgcggtacaggtccctggtgtaccagctgaacttc
gaccagacgctgaggaatgtagataaggccggctcctggacccctcgagagctggtgctg
gtggtccaggtgcataaccggcccgattacctcagactgctgctggactccctccggaaa
gcccagggcatcgacagcgtcctcgtcatctttagccatgacttctggtcgacagaaatc
aatcaactgatcgctggggtggatttctgtccggttctgcaggtgttctttcctttcagc
attcagttgtaccccaacgagtttccaggcagcgaccccagagattgcccccgagacctg
gagaagaatgcagctttgaagatgggatgcattaatgctgagtatcccgactcctttggc
cattatagagaggccaagttctcccaaaccaaacaccattggtggtggaagctgcatttt
gtatgggaaagggtcaaagttcttcgagactatgctggcctcatacttttcctagaggag
gatcactacttagccccagacttttaccatgtcttcaaaaagatgtggaagttaaagcag
caagagtgtcctgagtgtgatgttctctccctggggacctatacggccagtcgcagtttc
catggcattgctgacaaggtagacgtgaaaacttggaaatccacagagcacaatatgggt
ctagccttgacccgggatgcgtatcagaagttgattgagtgcacagacactttctgtact
tacgatgattataactgggactggactcttcaatatttaactgtatcctgtcttccaaaa
ttctggaaagtgctggttcctcaagttcctaggatatttcatgctggagactgtggtatg
caccacaagaaaacctgtagaccatccacccagagtgcccaaattgagtcactcttaaat
aataacaaacagtacttgtttccagacactctaactatcagtgagaagtttgtggcagcc
atttccccacctaggaaaaatggagggtggggagatattagggaccatgaactctgtaaa
agttatagaagactgcagtga

DBGET integrated database retrieval system