KEGG   Acinonyx jubatus (cheetah): 106987270Help
Entry
106987270         CDS       T04657                                 

Gene name
NPR1
Definition
(RefSeq) atrial natriuretic peptide receptor 1 isoform X1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00230  Purine metabolism
aju01100  Metabolic pathways
aju04022  cGMP-PKG signaling pathway
aju04024  cAMP signaling pathway
aju04270  Vascular smooth muscle contraction
aju04714  Thermogenesis
aju04921  Oxytocin signaling pathway
aju04923  Regulation of lipolysis in adipocytes
aju04924  Renin secretion
aju04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106987270 (NPR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    106987270 (NPR1)
   04022 cGMP-PKG signaling pathway
    106987270 (NPR1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    106987270 (NPR1)
   04921 Oxytocin signaling pathway
    106987270 (NPR1)
   04924 Renin secretion
    106987270 (NPR1)
   04925 Aldosterone synthesis and secretion
    106987270 (NPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106987270 (NPR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    106987270 (NPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106987270 (NPR1)
Enzymes [BR:aju01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106987270 (NPR1)
Protein kinases [BR:aju01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   106987270 (NPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 106987270
NCBI-ProteinID: XP_026904180
Position
Unknown
AA seq 1102 aa AA seqDB search
MLRPRRPGRPAGARLLPLPPLLLLLPLLLPGGHAGNLTVAVVLPLANTSYPWSWARVGPA
VELALARVRARPDWLPGWTVRTVLGSSENARGVCSDTAAPLAAVDLKWEHSPAVFLGPGC
VYAAAPVGRFTAHWRVPLLTAGAPALGFGAKDEYALTTRAGPSHAKLGDLVAALHRRLGW
ERQALVLYAYRPGDDQPCFFVVEGLYVRLRHRLNVTVDHLEFAEGDPQHYSLLLRTVRRQ
GRVIYICSSPDAFRTLMLLALEAGLSGEDYVFFHLDLFGQSLQGAHGLAPHRPWERGDGQ
DASAQQAFRAAKIITYKEPDNPEYLQFLQQLKHLAQEKFNFTLEDGLMNTIPASFHDGLL
LYIQAVTETLAHGGTFTDGEAVTQRMWNRSFQGVTGYWKMDSNGDRETDFSLWDMHPETG
TFRQRQAHVVATQLIKFSQEQEGIEATSAEEQITRGRLPGGGVVLNYNGTSRELVAVPGH
ELSWPLGHPPPDIPKCGFDNEDPACNQDHFSTLEVLAVVGSLSLLSILTVSFFVYRKMQL
ERDLASELWRVRWEDVQPSSLDRHLRSAGSRLTLSARGSNYGSLLTTEGQFQVFAKTAYY
KGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGS
LQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDF
GLESFRDPEPEQGHTLYAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVF
HVEGLDLSPKEIVERVTRGEQPPFRPSLALQSHLEELGQLMQRCWAEEPQERPPFQQIRL
MLRKFNREHSSNILDNLLSRMEQYANNLEELVEDRTQAYLEEKHKAEALLYQILPHSVAE
QLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYK
VETIGDAYMVVSGLPVRNGLLHAREVARMALALLDAVRSFRIRHRPQEELRLRIGVHTGP
VCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVE
MKGKGKVRTYWLLGERGGSTRG
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcccccggcgccccgggcgccccgccggcgcccgcctgctcccgctcccgccg
ctgctgctgctgctgccgctgctgctgcccggaggccacgcggggaacctgacggtggcc
gtggtgctgccgctggccaacacctcgtacccgtggtcgtgggcgcgcgtggggccggcc
gtggagctggcgctggcccgggtgagggcgcggcccgactggctgcccggctggacggtg
cgcacggtgctgggcagcagcgagaacgcgcggggcgtctgctccgacacggccgcgccg
ctggccgccgtggacctcaagtgggagcacagccccgccgtgttcctgggccccggctgc
gtgtacgccgcggcccccgtggggcgcttcacggcgcactggcgggtgccgctgctgacg
gccggcgcgccggcgctgggcttcggggccaaggacgagtacgcgctgaccacccgcgcg
gggcccagccacgccaagcttggggacctggtggcggcgctgcaccgacggctgggctgg
gagcgccaggcgctcgtgctctacgcgtaccggcccggcgacgaccagccctgcttcttc
gtggtggaaggcctgtacgtgcgcctgcgccaccgcctcaacgtcacggtggaccacctg
gagttcgcggagggcgacccccagcactactccctgctgctgcggaccgtgagacgccaa
ggccgagttatctacatatgcagctccccagatgccttcagaactctgatgcttttggcc
ctggaagccggcctgagtggggaggactatgtgtttttccacctggacctctttggacaa
agcctgcaaggtgcacacggtcttgctccccacaggccctgggagagaggcgatgggcag
gatgccagtgcccagcaggcctttcgggccgccaaaatcatcacatataaagagccggac
aaccctgagtacttgcaattcctgcagcagctaaaacacttggcccaggagaagttcaac
ttcaccctggaggacggcctgatgaacaccatcccagcgtccttccacgatgggctcctg
ctctacatccaggcagtgacagagactctggcacatgggggaaccttcactgatggggag
gccgtcactcagcggatgtggaaccggagcttccaaggggtgacaggatactggaaaatg
gacagcaatggagatcgggagaccgacttctccctctgggatatgcatcctgagactggc
actttcaggcagagacaggctcacgtggtggccacacagctcattaaattcagtcaggaa
caggaaggaattgaggccacaagtgctgaggagcagatcactcggggaagacttcctgga
ggaggggtggttctgaactacaatgggacctcccgagagctggtggccgtgccagggcac
gaactaagctggcccctgggccacccacctcctgacatccccaaatgtggctttgacaac
gaggacccggcttgcaaccaagaccacttttccacgctggaagttctggccgtggtgggc
agcctctccctgctcagcattctgaccgtctccttcttcgtatacaggaagatgcagctc
gagagggacctggcctcagagctgtggcgggtgcgctgggaggacgtgcagcccagcagc
ctcgacaggcacctccggagtgcaggcagccggctgacgctcagcgcgagaggctccaat
tacggctccctgctgaccacagagggccagttccaagtgtttgccaaaacggcatattat
aagggcaacctcgtggctgtgaagcgtgtgaaccgtaagcgcatcgagctgactcgtaaa
gtgctgtttgaactgaagcatatgcgggatgtacagaacgaacacctgaccaggtttgtg
ggtgcctgcactgacccccccaacatctgtatcctcacggagtactgtccccgtgggagt
ttgcaggacattctggagaatgagagcatcaccttggactggatgttccgatactctctt
accaatgacatcgtcaagggtatgctgttcctgcacaatggggccatttgctctcatggc
aacctcaagtcttccaactgtgtggtggacgggcgctttgtgctcaagatcactgacttc
gggctggagagcttcagggacccggaaccagagcaaggccacaccctctatgccaaaaag
ttgtggacagcccctgagctcctgcgaatggcctcaccccctgcccggggctcccaggca
ggtgacgtgtacagctttggaatcatccttcaggagattgccctgaggagtggcgtcttc
catgtggagggtttggaccttagccccaaagagatcgtggagcgtgtgactcggggtgag
cagccccccttccggccctccctggccctgcagagtcacctggaggagctggggcagctg
atgcagaggtgctgggctgaggagccgcaggaacggccccccttccagcagattcgcctg
atgctgcgcaagttcaacagggagcacagcagcaacatcctggacaacttgctgtcccgc
atggagcagtatgccaacaacctagaggagctggtggaggacaggacccaggcctacctg
gaggagaagcacaaggccgaggccctgctctaccagattctgccccactcagtggctgag
cagctcaagcgtggggagacagtccaggctgaagccttcgacagtgtgaccatctacttc
agcgacattgtgggcttcacagccctgtcggcagagagcactcctatgcaggtggtgacc
ctgctcaatgatctgtacacctgctttgatgccgtcatagacaactttgatgtgtacaag
gtggagaccattggcgatgcctacatggtcgtgtcggggctccccgtgcggaatgggctg
cttcacgcccgcgaggtggcccgcatggccctggcgcttctggatgctgtgcgctccttc
cgcatccgccaccggccccaggaggagctgcgcttgcgaatcggtgtccacacaggaccc
gtgtgcgccggcgtggtagggctgaagatgcctcgctactgcctcttcggagacacagtc
aacaccgcctccaggatggagtctaacggggaagccctgaagatccacttgtcttctgag
accaaggctgtcctggaagagtttggtggtttcgagctggagcttcgaggggacgtagaa
atgaagggcaaaggcaaagtgcggacctactggctcctaggggagcggggcggtagcact
cgaggctga

DBGET integrated database retrieval system