KEGG   Acinonyx jubatus (cheetah): 106987278Help
Entry
106987278         CDS       T04657                                 

Gene name
CDK14
Definition
(RefSeq) cyclin-dependent kinase 14 isoform X1
  KO
K08821  cyclin-dependent kinase 14 [EC:2.7.11.22]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    106987278 (CDK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106987278 (CDK14)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106987278 (CDK14)
Protein kinases [BR:aju01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106987278 (CDK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH TruB_C_2
Motif
Other DBs
NCBI-GeneID: 106987278
NCBI-ProteinID: XP_026927655
Position
Unknown
AA seq 469 aa AA seqDB search
MCDLIESQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIK
PLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKSSSTGKESPKVRRHSS
PSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIR
EASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQL
LRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPP
DVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGV
HSLPHFKPERFTLYSSKNLRQAWNKLSYVNYAEDLASKLLQCSPKNRLSAQAALSHEYFS
DLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacctcattgagtcgcagccggccgagaagatcggcaagatgaagaagttgcgg
agaactttgtcggagagtttcagccgcatcgctttgaagaaagacgacaccacctttgat
gagatatgtgtcacaaagatgtctacacggaactgccagggaatggactcagtgatcaaa
cccctggacacaattcctgaggataaaaaagtcagggttcagaggacacagagcactttt
gacccatttgagaaaccagctaatcaagtaaagagggtgcattccgagaacaatgcttgc
attaacttcaagtcctcctccactggcaaagagtcaccaaaagttaggcggcactccagc
cccagctcgccaaccagtcccaaatttggaaaagctgactcatacgaaaaactggaaaaa
ctaggggaaggatcttatgctacagtttacaaaggaaaaagcaaagtaaatgggaagttg
gtagccctgaaggtgatcaggctgcaagaagaagaaggtacaccttttacagctatcagg
gaagcctctctgttaaaaggactaaaacatgctaacatagtgctgcttcatgacatcatc
cacaccaaggagacgctgacacttgtgtttgaatatgtgcacactgatttatgtcagtac
atggacaagcaccctggggggctgcatccagataatgtgaagttgtttttatttcagttg
ctgcgagggctgtcttacatccaccagcgttatattttgcacagagacctgaaaccacag
aaccttctgatcagtgacacgggggagttaaagctggcagatttcggtcttgcaagagca
aaatctgtccctagccacacatactccaatgaagtggttaccttgtggtacagacctcca
gatgtcctcctgggctcaacagaatattccacctgccttgacatgtggggtgttggctgc
atctttgttgaaatgatccaaggagttgctgcttttccaggaatgaaagacattcaggat
caacttgaacgaatatttctggttctcggaacgccaaatgaggacacgtggcctggagtt
cattctttaccacattttaagccagaacgctttaccctgtacagctctaaaaaccttagg
caagcgtggaataagctcagctatgtgaattatgcagaggatctggcctccaagctccta
cagtgttccccaaagaacagactatcagcacaggctgccttgagccacgagtattttagt
gacctgcccccacggctatgggaactgaccgatatgtcttctatttttaccgtcccaaac
gtaagattgcagccagaagctggagaaagcatgcgggcctttgggaaaaacaatagttat
ggcaaaagtctatcaaatagcaagcactga

DBGET integrated database retrieval system