KEGG   Acinonyx jubatus (cheetah): 106987454Help
Entry
106987454         CDS       T04657                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K01203  sucrase-isomaltase [EC:3.2.1.48 3.2.1.10]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00052  Galactose metabolism
aju00500  Starch and sucrose metabolism
aju01100  Metabolic pathways
aju04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106987454 (SI)
   00500 Starch and sucrose metabolism
    106987454 (SI)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106987454 (SI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106987454 (SI)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     106987454 (SI)
    3.2.1.48  sucrose alpha-glucosidase
     106987454 (SI)
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106987454 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 106987454
NCBI-ProteinID: XP_014941233
Position
Unknown
AA seq 1827 aa AA seqDB search
MARKKFYGLEISLIVLFAIVTIIAIALIAVLATRTPAVEAISNSTSSPPTTRTTTVFPGS
GKCPSELNDPINERINCIPHQLPTKAVCSERGCCWKPWNDSLIPWCFFADNHGYNVERMI
TTSIGLEAKLNRKPSPTLFGNDITSVLITTQNQTPNRFRFKITDPNNRRYEVPHHFVKEF
TGTTASNTLYDVQVVENPFSIKVIRKSNNRILFDTSIGPLVYSDQYLQISTRLSSEYIYG
IGEHIHKRFRHDLNWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSN
AMEIFIQPTPIVTYRVIGGILDFYIFLGDTPEQVVQQYQELVGRPAMPVYWSLGFQLSRW
NYKSLDVVKEVVKRNRDAGIPFDTQVTDIDYMEAKKDFTYDKVAFKGLPEFVQDLHDHGQ
KYVIILDPAISIDKLSNGTAYATYERGNAKHVWVNDSDGTTAIIGEVWPGLTVYPDFTNP
NCIDWWADECSIFHQEVKYDGLWIDMNEVSSFVQGSKKGCNDNKLNYPPFTPDILDKLMY
SKTICMDAVQYWGKQYDVHSLYGYSMAIATEKAIEKVFPNKRSFILTRSTFAGSGSYAAH
WLGDNTASWEQMEWSITGMLEFNLFGMPLVGADICGFVVNTTEELCRRWMQLGAFYPFSR
NHNGDIYEHQDPAFFGQNSLLVNSSRHYLNIRYTLLPFLYTLFYKAHKFGETVARPVLHE
FYEDMNTWTEDTQFLWGPSLLITPVLKEGADTVSAYIPNATWYDYETGAKRPWKKQCVNM
YLPGDKIGLHLRGGYVIPIQQPAVTTNASRKNPLGLIVALDEDNTAKGDFFWDDGETKNT
IQNGRYILYTFSVSNNKLDMICTHSSYQEGNTLAFETIKILGLMDPVIQVTVVEDNQPMK
AHYNFTYTASNQSLLIYSLKFNLGRNFTVQWSQKFSENERFTCYPDADIATREKCEERGC
LWETPTFRSQAPSCYFPRQHNPYLVSTTQYSSMGITADLQLNTASARIKLPSEPIPTLRV
EVKYHKNDMLQFKIYDPQNKRYEVPVPLNIPAMPTSTYENRLYDVEIKENPFGIQIRRRS
TGRVIWDSHLPGFAFNNQFIQISTRLPSEYIYGFGEVEHRAFKRDLNWHTWGMFTRDQPP
GYKLNSYGFHPYYMALEDEGYAHGVLLLNSNGMDVTFQPTPALTYRIIGGILDFYMFLGP
TPEVATKQYHEVIGRPVMPPYWALGFQLCRYGYRNTSEVQQVYNDMVAAQIPYDVQYTDI
DYMERQLDFTIDENFRDLPEFVDKIRQEGMRYIIILDPAISGNETKPYPAFDRGQEKDVF
VKWPNTNDICWAKVWPDLPNVTIDENLTEDEAVNVSRAHVAFPDFFRNSTAEWWAKEIID
FYNNQMKFDGLWIDMNEPSSFVHGTVTNQCRNKELNYPPYVPEITKRTNGLHFRTMCMET
EHILSDGSPVLHYDVHNLYGWSQMKPTYDALQKTTGKRGIVISRSTYPTGGQWGGHWLGD
NYAQWDNLDKSIIGMMEFSLFGISYTGADICGFFNNSEYELCARWMQLGAFYPYSRNHNI
AFTRRQDPASWNETFSEMSKNILNIRYTLLPYFYTQMHEIHAHGGTVIRPLLHEFFNDKL
TWDIFKQFLWGPAFMVTPVLQPYRDTVAGYVPDARWFDYHTGQDIGVRGKFNEFEAPLYK
INLHVRGGHILPCQEPGLNTFYSRQNYMKLIVAADANQMAQGSLFWDDGESIDTYERDLY
FLVQFNLNKNTLTSTILKNGYINKNEMRLGFINIWGKGKTSVNEVNLIYNGNKVSVKFTQ
EANNEILNIDLTVNNVILDEPIEIIWS
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaagaaattttatggattagaaatctctctgattgtcctttttgctatagtt
actataatagctattgccctaattgctgttttagcaactaggacacctgctgttgaagcg
attagtaattctacttcaagcccacctaccactcgtacaaccactgtgtttcccggttca
ggaaagtgtccaagtgagctaaatgatcctatcaatgagagaataaattgcattccacat
caattaccaacaaaggcagtttgctcagagagaggctgctgctggaagccatggaatgac
tctcttattccttggtgcttcttcgccgataatcatggctataatgttgagagaatgata
acaacaagtattgggcttgaagccaaattaaacaggaaaccttcacctacgctctttgga
aatgacattactagtgttcttatcacaactcaaaatcagacacccaatcgtttccgattt
aagataactgatccaaataatagaagatatgaagttcctcatcattttgtaaaagaattt
actggtaccacagcttctaacacattgtatgacgtgcaggttgtagaaaatccatttagc
atcaaagttattagaaaaagcaataatagaattttgtttgacaccagcattggtcctttg
gtgtactctgaccagtatttacagatttcaaccagactttccagtgaatatatttatggc
attggggaacatattcataagagatttcgtcacgatttaaactggaaaacatggccaatt
tttacccgggatcaacttcccggtgacaataataataatttatatggtcatcagacattc
ttcatgtgcattgaagatacttctggaaagtcatttggtgttttcttaatgaacagcaat
gcaatggaaattttcatccagcctactccaatagtaacttacagagttattggcggaatt
ctggacttttacatctttctaggagatacaccagaacaagtagttcaacagtatcaagag
cttgttggacgacccgcaatgccagtatattggagtcttggattccagctgagtcgctgg
aattataagtcacttgatgtagtgaaagaagtggtaaaaagaaatcgggatgctggcata
ccatttgatacacaggtcactgatattgactatatggaagcaaagaaagactttacttat
gataaagttgcatttaaaggcctccctgaatttgttcaagatttgcacgaccatggacag
aaatatgtcatcatcttggatcccgcaatttccatagataagctaagcaatggaacggca
tatgccacctatgagaggggaaatgcaaaacatgtgtgggtaaatgattcagatgggact
acagcaattattggcgaggtgtggccaggattaacagtataccctgattttactaatcca
aactgcatagattggtgggcagatgaatgcagcattttccatcaagaagtgaaatatgat
ggactttggattgacatgaatgaagtttccagttttgttcaaggttcaaaaaaaggatgc
aatgacaataaactgaattatccaccttttactcctgatattcttgacaaactcatgtat
tccaaaacaatttgcatggatgctgtgcagtactgggggaaacagtatgatgttcacagc
ctctatggatacagcatggctatagccacagagaaagccatagagaaagttttccctaat
aagagaagcttcattctcacccgctcaacttttgctgggtctggaagctatgctgcacac
tggttaggggacaacactgcttcatgggagcaaatggagtggtctatcacaggaatgcta
gagttcaatttatttggaatgccattggttggagcggacatctgtggatttgtggttaat
accacagaagagctttgcaggaggtggatgcaacttggggccttttatccattttccagg
aaccataatggtgatatatatgagcatcaggatccagcattttttggacagaattctctt
ttggttaattcatcaaggcactatttgaatattcgctataccttattacctttcctatat
actctgttttacaaagcccataaatttggagaaacagtagcacggccagttcttcatgag
ttttatgaggatatgaatacctggactgaggacactcaattcttatggggcccctcatta
cttattactccagtcttgaaagagggagcagatacagtgagtgcatatatccctaatgct
acttggtatgattatgaaactggtgcaaaaaggccatggaaaaaacaatgtgttaatatg
taccttccaggagacaaaataggattacatcttagaggaggttatgttatccccattcaa
caacctgctgtaactacaaatgcaagccgaaagaaccctctaggacttatagttgcatta
gatgaagataacacagcaaaaggagactttttctgggatgatggtgaaactaaaaatacc
atacaaaatggcagatacattttatatacattttcagtttctaataacaaattagatatg
atatgcacacattcatcataccaggaaggaaacacattagcatttgagactattaaaatc
cttgggttgatggatcctgttatacaagtcacagtggtggaagataatcagccaatgaaa
gctcactacaattttacttatacagcttccaaccagagtctcttaatttatagtctcaag
tttaaccttggaagaaactttaccgttcaatggagtcaaaaattctcagaaaatgaaagg
tttacttgttatccagatgcagacattgcaactagagaaaagtgtgaagaacgtggctgt
ttatgggaaacgcctacctttagatcccaggcacctagctgttactttcctagacaacac
aacccttatttagtcagtacaactcaatattcatcaatgggtataacagctgacctccag
ctgaatactgcaagtgctcgaataaagctaccttctgaacccataccaacacttcgtgtg
gaagtgaaatatcacaaaaatgatatgctgcaatttaagatttatgatccccaaaataag
agatatgaagttccagtacctttaaacattccagccatgccaacaagtacttatgaaaat
agactttatgatgttgaaatcaaggaaaatccttttggcatccagattcgaaggagaagc
acaggaagagttatttgggattctcacctgcctggatttgcttttaataaccagtttatt
caaatatctactcgcttgccatcagaatatatatatggttttggggaagtggaacacaga
gcatttaagagagacctgaactggcatacttggggaatgttcacaagagaccaaccccct
ggttataaacttaattcctatggatttcatccatattacatggctctggaagatgaaggc
tatgctcatggagttctcttacttaacagcaatggaatggatgttacttttcagccaact
cctgctctaacttaccgcataattggaggaatcttggatttctatatgtttttgggtcca
actccggaagttgcaacaaaacaataccatgaagtaattggccgaccagtcatgccacct
tactgggctttgggatttcaattatgtcgttatgggtacagaaatacttcagaggttcag
caagtatataacgatatggtggctgctcagatcccttatgatgttcaatacacagacatt
gattacatggaaagacaactagactttacaattgatgaaaacttccgtgatcttcctgag
tttgttgacaaaataagacaggagggaatgagatacattattatcctggatccagccatt
tcaggaaatgaaacaaagccttaccctgcatttgacagaggacaggagaaagatgttttt
gtcaaatggcctaacaccaatgatatttgttgggcaaaggtttggccagatttgcccaat
gtaacaatagacgaaaatctaactgaagatgaagctgttaatgtttccagagctcatgta
gcttttccagattttttcaggaattccacagcagagtggtgggcaaaggaaattatagat
ttctacaataaccagatgaagtttgatggcttgtggattgatatgaatgaaccatccagt
tttgtacatggaacagttactaatcaatgcagaaataaagagttaaattatccaccttat
gtcccagaaatcacaaaaagaacaaatggattacatttcagaactatgtgtatggaaact
gaacatattcttagtgatggatcacccgttttgcattatgatgttcacaatctatatgga
tggtcacaaatgaaacctacttatgatgcattgcagaagacaactggcaaaagaggaatt
gttatttctcgttcaacatatcctactggtggacaatggggaggacactggcttggagac
aactatgcacagtgggacaatttggacaaatcaatcattggtatgatggaatttagtctc
tttggaatctcatatactggtgcagatatctgtggtttcttcaacaactcagagtatgag
ctctgtgcccgctggatgcaacttggagcattttacccatactcaagaaatcacaacatt
gcatttactaggagacaagatcctgcttcctggaatgaaactttttctgaaatgtcaaag
aatattctaaatattagatacactttattaccctatttctatacacagatgcatgaaatt
catgctcatggtggcactgttattcgaccccttttgcatgagttctttaatgacaagcta
acctgggatatattcaagcagttcttgtggggtccagcgtttatggttacccctgtactg
caaccttatagggacactgtagcaggctacgtccctgatgctcggtggtttgattatcat
acgggccaagatattggtgtcagaggaaaatttaatgaatttgaagctcctttatataaa
ataaacctacatgtccgtggtggtcacattctaccatgtcaagagcctggtttaaacaca
ttttacagtcgacaaaactacatgaagctcattgttgctgcagatgctaatcagatggca
cagggatctctgttttgggatgatggagagagtatagacacctatgaaagagacttatat
ttcctggtacagtttaatttgaacaagaataccttgacaagcactatattgaaaaatggt
tacataaacaaaaatgaaatgaggcttggattcatcaacatatgggggaaaggaaagact
tctgttaatgaggttaatctcatatataatggaaataaagtgtcagttaaatttactcaa
gaggcaaacaacgagatattaaatattgatctgacagtaaataatgttattcttgatgaa
ccaatagaaatcatctggtcatga

DBGET integrated database retrieval system