KEGG   Acinonyx jubatus (cheetah): 106987869
Entry
106987869         CDS       T04657                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00230  Purine metabolism
aju01100  Metabolic pathways
aju01522  Endocrine resistance
aju04015  Rap1 signaling pathway
aju04020  Calcium signaling pathway
aju04022  cGMP-PKG signaling pathway
aju04024  cAMP signaling pathway
aju04062  Chemokine signaling pathway
aju04072  Phospholipase D signaling pathway
aju04114  Oocyte meiosis
aju04211  Longevity regulating pathway
aju04213  Longevity regulating pathway - multiple species
aju04261  Adrenergic signaling in cardiomyocytes
aju04270  Vascular smooth muscle contraction
aju04371  Apelin signaling pathway
aju04540  Gap junction
aju04611  Platelet activation
aju04713  Circadian entrainment
aju04714  Thermogenesis
aju04723  Retrograde endocannabinoid signaling
aju04724  Glutamatergic synapse
aju04725  Cholinergic synapse
aju04727  GABAergic synapse
aju04742  Taste transduction
aju04750  Inflammatory mediator regulation of TRP channels
aju04911  Insulin secretion
aju04912  GnRH signaling pathway
aju04913  Ovarian steroidogenesis
aju04914  Progesterone-mediated oocyte maturation
aju04915  Estrogen signaling pathway
aju04916  Melanogenesis
aju04918  Thyroid hormone synthesis
aju04921  Oxytocin signaling pathway
aju04923  Regulation of lipolysis in adipocytes
aju04925  Aldosterone synthesis and secretion
aju04926  Relaxin signaling pathway
aju04927  Cortisol synthesis and secretion
aju04928  Parathyroid hormone synthesis, secretion and action
aju04934  Cushing syndrome
aju04935  Growth hormone synthesis, secretion and action
aju04970  Salivary secretion
aju04971  Gastric acid secretion
aju04972  Pancreatic secretion
aju04976  Bile secretion
aju05032  Morphine addiction
aju05163  Human cytomegalovirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106987869 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    106987869 (ADCY4)
   04371 Apelin signaling pathway
    106987869 (ADCY4)
   04020 Calcium signaling pathway
    106987869 (ADCY4)
   04072 Phospholipase D signaling pathway
    106987869 (ADCY4)
   04024 cAMP signaling pathway
    106987869 (ADCY4)
   04022 cGMP-PKG signaling pathway
    106987869 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106987869 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106987869 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106987869 (ADCY4)
   04062 Chemokine signaling pathway
    106987869 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    106987869 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    106987869 (ADCY4)
   04912 GnRH signaling pathway
    106987869 (ADCY4)
   04913 Ovarian steroidogenesis
    106987869 (ADCY4)
   04915 Estrogen signaling pathway
    106987869 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    106987869 (ADCY4)
   04921 Oxytocin signaling pathway
    106987869 (ADCY4)
   04926 Relaxin signaling pathway
    106987869 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    106987869 (ADCY4)
   04918 Thyroid hormone synthesis
    106987869 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    106987869 (ADCY4)
   04916 Melanogenesis
    106987869 (ADCY4)
   04925 Aldosterone synthesis and secretion
    106987869 (ADCY4)
   04927 Cortisol synthesis and secretion
    106987869 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106987869 (ADCY4)
   04270 Vascular smooth muscle contraction
    106987869 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    106987869 (ADCY4)
   04971 Gastric acid secretion
    106987869 (ADCY4)
   04972 Pancreatic secretion
    106987869 (ADCY4)
   04976 Bile secretion
    106987869 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    106987869 (ADCY4)
   04727 GABAergic synapse
    106987869 (ADCY4)
   04725 Cholinergic synapse
    106987869 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    106987869 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    106987869 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    106987869 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    106987869 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    106987869 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    106987869 (ADCY4)
   04714 Thermogenesis
    106987869 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106987869 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    106987869 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    106987869 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106987869 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106987869 (ADCY4)
   05163 Human cytomegalovirus infection
    106987869 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    106987869 (ADCY4)
Enzymes [BR:aju01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     106987869 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 106987869
NCBI-ProteinID: XP_014941687
Position
Unknown
AA seq 1081 aa
MVQPTTNGKSRCPVSFCYLSLRHISEVAWGGCLFFFSLEAFPHTPHSSLAASTLSSQEIA
SDPGFLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWAALLGLGHGFLFTGGLVSA
WDQVSFFLFVIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSKPALLPQLAA
NAVLFLCGNVAGAYHKTLMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLA
REMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVL
MLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLR
AATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLA
LLAGAYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSL
LMTRYLESWGAAKPFAHLSHLESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDDLDT
GDAKFFQVIEQLNSQKQWRQSKDFNPLTLYFRKKELEKEYRLSALPAFKYYAACTFLVFL
SNFIIQMLVTNRPPALAITYSITFLLFLLLLFVCFSEHLTRCVLKGPKMLHWLPALSGLV
ATRPGLRVALGTATILLVFVMAIPSLFFLPAASNCPFGALNVSSMAFNISWELPGSLPLI
SVPYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLGASCSLFLHSHAWLSDCLIARLYPD
PSDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMEN
LTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGL
ECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHL
GTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASR
MESTGVLGKIQVTEETARVLQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLARTGPPSATL
G
NT seq 3246 nt   +upstreamnt  +downstreamnt
atggttcaacctactacgaatggcaagtcgaggtgccctgtctccttttgctacttgagt
ttgagacacatttcagaagtggcctgggggggctgcctgttcttcttcagcttggaggcg
ttcccccatactccacactccagtcttgctgcaagcaccctctcctcgcaggagatagct
tcagacccaggcttcctgaccactgtgctgtgcgcgctgggtggcttctcgctgctcctg
ggcttggcttcccgggagcaacgactgcagcgctggacacgtcccctgtcgggcctcgta
tgggcagcgctactcgggctaggccacggcttcctgttcactgggggcctggtgagcgcc
tgggaccaggtgtcctttttcctctttgtcatcttcaccgtgtacgccatgttgcccttg
ggcatgcgggatgccgctgctgcgggccttgcctcatcgctctcccacttgctggtcctt
gggctgtaccttgggcctcagccggactcaaagccggcgctgctgccacagctggcagcg
aacgcggtgttgttcctgtgcgggaacgtggcgggagcgtatcacaagacgctgatggag
cgcgcgctgcgcgccacgttccgcgaggcacttagctccctgcactcgcgccggcggctg
gacaccgagaagaagcaccaggaacaccttctcttgtccatccttcctgcctacttggcc
cgagagatgaaggcagagatcatggcacgactgcaggctggacaggggtcacggccagaa
agcaccaacaacttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtat
gctgacatcgtgggcttcacccggctggccagtgagtgctctcctaaggagttggtgctc
atgctcaacgagctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcgg
atcaagatcctgggagactgttactactgtgtctctgggctaccgctctccctgccagac
cacgccatcaactgcgtgcgcatggggctggacatgtgccgggccatcaggaagctccgg
gcagccactggcgtggacatcaacatgcgtgtgggcgtgcattcgggcagtgtgctctgc
ggagtcattgggctgcagaagtggcagtatgatgtctggtcccatgatgtcacactggcc
aaccacatggaggcgggtggcgtgccaggacgagtgcatattacaggggctaccctggcc
ctgctggcaggggcttatgctgtggaggatgcagccatggaacaccgggacccatacctt
cgggagctaggggagcctacctacctagtcatcgatccccgggctgaggaggaggatgag
aagggcactgcaggagggttgctgtcctctctcgagggccccaagatgcgtccgtcgctg
ctgatgacccgctacctggagtcctggggcgccgccaagccttttgcccatctgagccac
ctagagagccctgtatccacctctacccctctcccggagaaggccctggcttccttcagc
ccccagtggagcctggaccggagccgtaccccccgggggctagatgatgacctggacact
ggggatgccaagttcttccaggtcatcgaacagctcaactctcagaaacagtggaggcag
tcaaaggacttcaacccactgacactgtacttcagaaagaaggaactggagaaagagtac
cgactctctgccctccccgccttcaaatactatgcagcctgcaccttcctggttttcctt
tccaatttcatcatccagatgctggtgacaaacaggcccccagctctggccatcacctat
agcatcaccttcctcctcttcctcctcctcctcttcgtctgcttctcagagcacctgacg
aggtgtgtcttgaaaggccccaagatgctgcactggctgccggcactgtctggcttggtg
gccacacggcccggactgcgagttgccctgggcacagctaccatcctcctggtttttgtg
atggccattcccagcctgttcttcttaccggcagcatcaaactgcccttttggggctctc
aatgtgtcctccatggctttcaacatctcctgggagctccctgggtccctgcctctcatc
agcgtcccttactctatgcactgctgcgtgctggggttcctgtcctgctccctctttttg
cacatgagcttcgagctgaagttgctgctgctcctgctatggctgggggcctcctgctcc
ctcttcctgcactcccacgcctggctgtctgactgcctcatcgcccgcctctatccggat
ccctcggactccaggccaggggtgctgaaggagcccaaactgatgggagctatctccttc
ttcatcttcttcttcaccctcctggtcctggctcggcagaatgagtattactgccggctg
gacttcctgtggaagaagaagctgcggcaggagcaggaggagacagagaccatggagaac
ctgactcggctgctgttggagaatgtgctccctgcacatgtggccccccagttcattggc
cagaaccggcgcaacgaggacctctaccaccagtcctatgagtgtgtctgtgtcctgttc
gcctcagttccagacttcaaggagttttactctgagtccaacataaaccacgagggtcta
gagtgtctgcggctgctcaatgagataattgctgattttgatgagctgctctcaaagccc
aagtttagcggggtggagaagatcaaaaccatcggtagcacctacatggcagctacaggc
ttaaatgccacctccggacaggacgcacagcaggacgctgagcgcagctgcagccatctt
ggcaccatggtggagtttgcggtggctcttggatcaaagctggacgtcatcaataagcac
tctttcaacaacttccgcttgcgtgtggggttgaaccacggacctgtagtggctggagtg
atcggggcccagaagccgcagtatgacatctggggcaacacagtgaacgtggccagccgc
atggagagtacaggagtcctgggcaagatccaggtgactgaagagacggcccgggtgctg
cagtccttaggctacacctgctacagccggggtatcatcaaggtcaaaggcaaagggcag
ctctgcacctactttctgaacacagatttggcacgaactggacctccctcggccacccta
ggctga

DBGET integrated database retrieval system