KEGG   Acinonyx jubatus (cheetah): 106988263
Entry
106988263         CDS       T04657                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aju01002]
    106988263 (ADAMTS13)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     106988263 (ADAMTS13)
Peptidases and inhibitors [BR:aju01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   106988263 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 ADAM_spacer1 TSP1_CCN Peptidase_M10 Reprolysin_2 DUF4953
Other DBs
NCBI-GeneID: 106988263
NCBI-ProteinID: XP_026907503
UniProt: A0A6J1YS55
Position
Unknown
AA seq 1645 aa
MLLSPVQPVTSQGVCHIPHRPDFQSQGSLPLSRLVFLRMREPRPWGSCVGATLTSAFFLL
GCWGRSDFQQQFLQALEPEEVTSYFGPDATLEVLQFDMAPLTCICEDGPGGPPRRAPSCS
LLALGQLFAFSFPPERSLLTASFTSEHVLNASLRLERRPPHPCFAGGRPLLPLGAVARVT
YCSGHLEGDVLVGADRFRVQPVRRRHWELLPPRVRAQPHLVHRGSPEAPQVTRGRPPSPR
LRLRRWAASRVLHLELLVAVGPDVYQAHQEDTERYVLTNLNMGSELLRDPSLGTQFRVHL
VKMVTLTQPEDAPNITANITASLLSVCEWSRTVNPEDDTDPGHADLVLYITRFDLELPDG
NRQVRGVTQLGGVCSSSWSCLITEDTGFDLGVTIAHEIGHSLGLEHDGAPGSGCGPSGHV
MASQDAATARGDLSWSACSRQQLLHLLSAGRVRCLWDPPGPQAGAAGSPPRAQPGLHYGA
DEQCRVAFGPAAVACTFTRGHLDVCQALSCHEDPLDQSVCSRLLTPLLDGTECGEQKWCS
KGHCRSLAELTPVGVVHGHWSSWGPPSPCSRSCGGGVVTRRRQCSNPRPAFGGRACVGDD
LQAEMCNTQACEKTQLDFMSEQCSWTDRKPLHLSPGNTSFYRWGSAEQYSQGDALCRHMC
RAIGETFIVRRGDSFLDGTRCVPSGRREDGTLSLCVSGSCRTFGCDGRMDSQQVRDACQV
CGGDNSTCSPRNGSFTAGRAREYVTFLTVTRNLTSIYVANQKPLFTHLAVRIGGRYVVAG
NSGISPSTTYPSLLEDSRVEYSVTLTEDRLPHLEEIRIRGPTREHVEIQVYRRYGEEYGD
LARPDITFTYFQPKQPQAWAWAAVRGPCSVSCGAGLRWVTYSCLDQARNEWAEAARCEGS
QRPAAWPESCAPGPCPPDRRNHPPVPPRPAPASESSTRRRGPDATCQGSHAHEMQRPSPI
WVTRFCHGSDIITWTEACCPLWKAGGRQESDTCSSACEAHLALHNGTCMHGAGGPDALAT
AGPCSTDEKLPALEPCVATACPPAQGHTDPQSLEEEATSPPAPARPGARAAHVWTPLAGP
CSVSCSRGLKELHFVCVDSVLGTPVQEELCDLGSKPGSRREVCQAAPCPAWWETRALVPC
PVTCGGGRVPLAVRCVRLDRGRPIPLPHSKCWPLPRPRPVRDCSPEPCPARWQYKLAACS
VSCGGGVARRILYCARAHRRDEGEEILPDTQCLGLPRPEQQEPCGPEPCPPRWKIVSLGP
CSASCGLGTATRSVACVQFDQGQDVEVDGAACVALVRPQASIPCITADCAYRWRVSTWTQ
CSVSCGDGIQHRHDACLGPGSQAPVPAHFCQHLPKPATVRGCWAGPCAGQGTPSPAPPEE
ATAGAPPEQPRPQAHLLSPAPRLQGLLPGPQESPAVSSVCGRQHLEPTGTIDMRGPGQAD
CVVAIGRPLGEVVTVQVLESSLNCSTGDMLLLWGRLTWRKMCGKLSDMTFSSKANTLLVR
QRRERPEGGVVLRYRSQPAPGASHRECDMQLFGPWGKIVSPSMSPRGRNLGGCRIFINVA
PRARIAIHALVTSVGTGTDASHILIRDIHSLKTMTFRGQQALYWESEGSQAEMEFSQGFM
EAGASLWGLYWTLGSRVQEPGWAVP
NT seq 4938 nt   +upstreamnt  +downstreamnt
atgttgctgtctccggtgcagcctgtcaccagccaaggggtctgccacattccacaccgg
ccagatttccagtcacaaggctctctccctctgagcaggctggttttcctgaggatgagg
gagcctcgcccctgggggagctgcgtgggggcaacgctcacttctgccttctttctcctg
ggctgctggggacgctccgatttccagcagcaatttctccaagctttggagccagaggaa
gtgacttcttattttggccccgatgctaccttagaagtgctgcaattcgacatggccccg
ctcacctgcatctgtgaggatgggcccggggggcctccccgcagggccccgagctgctct
ctgctcgccctgggacagctctttgccttctccttcccgccggagcggagcctcctcacc
gcctccttcaccagcgagcacgtgctgaacgcctccctccggcttgagaggcggcctccc
catccctgcttcgcgggaggccgccccctgctgcccctgggcgcagtggccagggtcacc
tactgctcaggccacttggagggcgacgtcctggtgggcgcagacaggttccgcgtccag
ccggtgaggaggcggcattgggagctgctgcctccccgggttcgtgcgcagccccacctg
gtccacaggggcagccccgaggccccccaagtcacccgaggccgtcctccttcccctcgc
cttcgcctccggagatgggctgccagcagggtcctgcacctggagctgctggtggccgtg
ggccccgacgtctaccaggctcaccaggaggacactgagcgctacgtgctcaccaacctc
aacatggggtcagagctgctgagggacccatccctggggactcagttccgagtgcatctg
gtgaagatggtcaccctgacccagcctgaggatgctccgaatatcacagccaacatcacg
gcctcactgctgagtgtctgtgagtggagcaggacggtcaaccccgaggacgacacagat
cctgggcatgccgacctggtcctctacatcaccaggtttgacctggagttgcctgatggt
aaccggcaggttcggggggtcacccagctggggggtgtctgctcgtcctcctggagctgc
ctcatcactgaggataccggctttgacctgggggtcaccatcgcccatgagattgggcac
agcttgggcttggaacacgacggcgcgcccgggagcggctgtgggcccagcggccacgtg
atggcgtcccaggacgcggcgaccgccaggggtgacctctcgtggtccgcctgcagccgc
cagcaactgctgcacctgctcagcgcaggacgggtgcgctgcctgtgggacccgccgggg
ccgcaggccggggccgcggggagccctccccgggcgcagcccggcctccactacggcgcg
gacgagcagtgccgcgtcgccttcggccctgcagcggtggcctgcaccttcaccaggggg
cacctggacgtgtgccaggctctctcctgccacgaggaccccctggaccaaagcgtctgt
agccgcctcttgactcccctcctggatgggacagagtgtggcgagcagaagtggtgctcc
aaaggtcactgccgctccctggcggagctgacccccgtgggagtggtgcacgggcactgg
tctagctggggtccccccagtccctgctcccgttcctgcgggggaggggtggtcaccagg
aggcgacagtgcagcaaccccaggccggcctttggagggcgtgcgtgtgtgggcgatgac
ctccaggcggagatgtgcaacacccaggcctgtgagaagacccagctggacttcatgtct
gagcagtgctcctggacggacaggaaaccactacacctgtccccaggcaacacctccttc
taccgctggggctccgctgagcagtacagtcaaggggacgctctgtgcagacacatgtgc
cgagccatcggcgagaccttcattgtgaggcgtggggacagtttcctggatgggacccgg
tgtgtgccaagtggtcggcgggaggacgggaccctgagcctgtgcgtgtcgggcagctgc
aggacgttcggctgtgacggcaggatggactcccagcaggtgcgagacgcgtgccaggtg
tgtggaggggacaacagcacgtgcagcccccgcaacggctctttcacggccggaagagcc
agagagtatgtcacgttcctgacggttacccgcaacctgaccagcatatacgtcgccaac
cagaaacctctcttcacacacttggcggtgcggatcggagggcgctacgtcgtggccggg
aactctggcatctctcccagcaccacctacccctccctcctggaggacagccgtgtcgag
tacagcgtgaccctcaccgaggaccggctgcctcacctggaggagatccgcatccgggga
cccactcgggaacacgtggagatccaggtttacaggcgctacggggaggagtatggtgac
cttgcacgcccagacatcaccttcacctacttccagccgaagcagccacaggcctgggca
tgggccgccgtgcgggggccctgctccgtgagctgtggggcagggctgcgctgggtgacc
tacagctgtctggaccaggccaggaacgagtgggcggaggctgcccggtgcgaagggagc
cagcggccggcagcgtggccagagtcctgcgcccctgggccctgccccccagatcgtagg
aaccacccccctgtcccaccgaggcccgcgcctgcctccgaatcctcaacacggcgccgc
gggcccgacgccacctgtcagggttcacacgcacacgagatgcagcggccatccccgatc
tgggtgacccgattctgtcacggcagtgatattattacgtggacagaggcctgctgtcct
ctctggaaggcaggagggcgccaggagtcggacacgtgctcatcagcctgtgaggcccac
ctggctttgcacaacgggacgtgtatgcacggggcaggtggcccggacgcgctggccaca
gccgggccctgctccacagacgagaagctgcccgccctcgagccgtgtgtggccacggca
tgtcctccggcacagggccacacagacccccagtctctagaggaggaggccacatcccca
ccggcccctgccaggccgggggcccgcgccgcccacgtgtggactcccctggcggggccg
tgctctgtctcctgcagtcgaggcctgaaggagctgcatttcgtgtgcgtggactctgtc
ctggggacccctgtccaggaagagctatgtgacctgggaagcaagcctgggagccggcgg
gaggtctgccaggctgccccgtgcccggcttggtgggagacccgagccttggtgccgtgc
ccagtgacctgcggaggggggcgggtgccactggctgtccgctgcgtgaggctggaccgc
ggtcgccccatccccctgcctcactccaagtgctggccgctgcccaggccccgccccgtc
cgggactgcagtccggagccctgccctgccaggtggcagtacaagctggcagcctgcagc
gtgagctgtggaggaggggtcgcacggaggatcctgtattgcgcacgggcccacaggagg
gacgagggcgaggagatcctgccggatacccagtgcctggggctgcctcgcccggagcag
caggagccgtgcggcccggagccctgcccacccaggtggaaaatcgtgtcccttggccca
tgctcagccagctgtggccttggcaccgccacacgctccgtggcctgtgtgcagttcgat
caaggccaggacgtcgaggtggacggggcggcctgtgtagctttggtacggcctcaggcc
agcatcccctgcatcaccgccgactgcgcctaccggtggcgtgtcagcacctggacacag
tgctctgtctcctgcggagacggcatccagcaccggcacgatgcctgccttggacccggg
tcccaggcaccggtgccagcccacttctgccagcacttgcccaagccagccacggtgcgg
ggctgctgggctgggccctgcgctgggcaggggacccccagcccggcgccccccgaggaa
gccactgctggtgctcctccggagcagccccggccccaggcccacctcctctccccagct
ccccggcttcaggggcttctgcctgggccccaggaaagcccggctgtgtccagcgtctgt
ggccggcagcaccttgagccgacaggaaccattgacatgcgaggcccagggcaggctgac
tgtgtagtggccatcgggcggcccctgggtgaggtggtgaccgttcaagtcctcgagagt
tccctcaactgcagcactggggacatgttgctgctttggggcaggctcacgtggaggaag
atgtgcgggaaactgtcggacatgactttcagctccaaagccaacacgctcctggtgagg
cagcgccgtgagcggccggaaggcggagttgtgctgcggtaccggagccagcctgccccg
ggagcctcccacagagagtgtgatatgcagctctttggaccctggggtaaaatcgtgagc
ccctcgatgagtccacgtgggaggaacctggggggctgccgcatcttcatcaatgtggct
ccacgggcccgcattgccatccatgccctggtcaccagcgtgggcacaggcactgatgcc
agccacatcttgatccgggacatccacagcctgaagacgatgacattccgtgggcagcag
gcactctactgggagtccgagggaagccaggctgagatggagtttagccagggcttcatg
gaggcgggcgctagtctgtggggcctgtactggaccctcggatctcgagtgcaggaacct
ggctgggccgtaccctag

DBGET integrated database retrieval system