KEGG   Acinonyx jubatus (cheetah): 106988356Help
Entry
106988356         CDS       T04657                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106988356 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aju03041]
    106988356 (DHX8)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106988356 (DHX8)
Spliceosome [BR:aju03041]
 Complex C
  Other components
   Step II factors
    106988356 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH ABC_tran Sigma54_activ_2 Presenilin
Motif
Other DBs
NCBI-GeneID: 106988356
NCBI-ProteinID: XP_014942285
Position
Unknown
AA seq 1222 aa AA seqDB search
MAVAVALAGAVTGTELGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTGKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAGQEKQRDAEHRDKTKKKKRSRSR
DRDRDRERDRERERDRDRDHKRRHRSRSRSHSRTRERNKGKSRYRSRSRSQSPPKDRKDR
DKYGERNLDRWRDKHVDRPPPEEPAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHIS
ELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGET
NEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPD
FDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMM
QSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEW
KKHAFGGNKASYGKKTQMSIIEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQI
TQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVI
KYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSA
TLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILV
FLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIA
TNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGK
CYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAM
EQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVF
YRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDI
RKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPS
SALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRL
EPLYNRYEEPNAWRISRAFRRR
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggccgtggccctggcgggggctgtgaccggaacggagctaggccccgcggaa
gaactcgccaaactcgagtatctgtctttagtgtcgaaagtttgcaccgagctggacaat
cacttggggatcaacgacaaggacctggctgaatttgtgatcagtcttgctgagaaaaat
accacgtttgatacttttaaggcttctctggtcaaaaatggtgctgaattcacggattct
cttattagtaacttgctacgcctcatacaaaccatgcggcctccagcaaagccttctact
agcaaagatccagttgttaaacccaaaactggaaaggaaaagctgaaggaactcttccca
gtgctttgtcaaccagacaacccttctgtccggaccatgctggatgaggatgatgtgaaa
gtcgctgtggatgtcctgaaagaactggaggccttaatgcccagtgcagcgggccaggag
aagcaaagagatgcagagcaccgagacaagacaaagaagaagaagcggagccggagccgt
gaccgtgaccgcgaccgcgagcgtgaccgggagcgggagcgagaccgtgatagagaccac
aagaggagacaccggtcccgctctcggtcacattccaggacccgggagaggaataaaggg
aagtctagatatcggtctaggagcagaagtcagagtccccccaaagaccggaaggaccgg
gacaagtatggggagaggaatctggacagatggagggataaacacgtggaccgccctccc
ccggaggagcctgccattggggacatttacaatggcaaagttaccagcatcatgcagttt
ggatgcttcgtgcagctagagggattaaggaagcggtgggaaggcctggtgcacatctct
gagctccggcgagaaggccgtgtggccaatgtggctgatgtggtgagcaaaggccagagg
gtcaaagtcaaagtgctatccttcactgggaccaagaccagtctgagcatgaaggatgtg
gatcaagagactggtgaagatctaaatcccaatcgacgacgaaatcttgttggggagacc
aatgaagagacttcaatgaggaatccggacagacccactcacctttcccttgtcagcgcc
cctgaagtagaggatgactctctggagcgcaagcgccttacccgcatctctgatccagag
aagtgggagatcaaacagatgatcgctgccaatgtcctttccaaagaagagtttccggac
ttcgatgaagagactggcattctccctaaagtggatgatgaagaagatgaagatcttgag
atcgagctggttgaggaagagcctccattcctgagagggcacaccaagcaaagcatggac
atgagccctattaaaatcgttaagaacccggatggttccctctcccaagcagcaatgatg
cagagtgccttagccaaagaaaggcgggaactcaagcaggcccagcgggaagctgagatg
gattctattcccatggggctcaacaaacactgggttgatcctctgcctgatgcggaaggc
agacagatcgctgccaatatgaggggtattgggatgatgcccaatgacattcccgagtgg
aagaagcatgcttttgggggcaacaaagcttcttatggaaaaaagacccagatgtcaatc
attgaacagagagagagcctgcccatctacaaactgaaggagcagctggtccaggctgtt
catgacaatcaaatcctgattgttattggagagacaggatctgggaagacaacgcagatc
acccaatacctggcagaggcaggctacacttcccggggcaagattggatgtacccagccc
cgaagagtagcagccatgtcggtggccaaaagagtgtcggaggagtttggttgttgctta
ggccaggaggtgggctacaccattcggtttgaggactgcaccagcccagaaacagtcatc
aagtacatgacagatgggatgttgctgcgagagtgcctgattgatcccgacctcacacag
tatgcaatcatcatgctggatgaggcacacgagagaacaattcacactgacgtgctcttt
ggattgttgaagaagacggttcagaaacggcaggacatgaagctgattgtcacctcagcc
acattggatgcagtgaagttttctcagtacttctatgaagctcccatcttcaccatccca
ggtcgaacatatccagtggaaatactgtacacaaaggaacctgagacagattatctagat
gccagcttgatcactgtcatgcagatccacttaacagaaccaccaggtgacatcctcgtc
ttcctgactggtcaggaggagatcgataccgcgtgcgagatcctatacgaaagaatgaaa
tccctgggaccggatgtcccggagctgatcatcctgcccgtgtactctgctctccccagt
gagatgcagacccgaatctttgacccagccccacctggcagcagaaaggtcgtgattgcc
accaacatcgcagagacctcgctgaccattgacggcatctactatgtggtggaccctggg
tttgtgaagcagaaagtttacaattccaagactggcatcgaccagctcgtggtcactcca
atctctcaggctcaggcaaagcagcgagctggcagagccgggagaaccggcccagggaag
tgttacaggctgtacacagaacgtgcctaccgagatgaaatgctgaccaccaatgtgccg
gaaatccagaggaccaacctggcgagcacagtgctctctctcaaggccatgggcatcaat
gacctgctgtcctttgacttcatggatgcccctccgatggaaaccttgatcacagccatg
gagcaactgtacacactgggggccttggatgacgagggcctgcttactcgcctgggccgc
aggatggcagaattccctctggagccaatgctgtgcaaaatgctgatcatgtctgtgcat
ctgggctgcagtgaggaaatgctgaccattgtgtccatgctgtctgtgcagaatgtcttc
tacaggcccaaggataaacaagcccttgcagatcaaaagaaagctaaattccaccagacc
gaaggggaccacctcaccctgctggctgtgtacaactcctggaagaacaacaagttctcc
aacccctggtgctatgagaacttcatccaggctcgttcactgcgtcgggcccaggatatt
cgcaagcagatgttaggcataatggacagacacaagctggatgtggtctcctgtggcaag
tccacagtccgagtgcaaaaggccatctgcagtggattcttccggaatgctgccaagaaa
gaccctcaggagggctaccggacactgattgaccaacaggtggtctacatccacccttcc
agtgctctcttcaatagacagccagaatgggtggtgtatcacgagctggtactgaccacg
aaggagtacatgcgtgaggtcaccactatcgaccccaggtggcttgtggaatttgctcca
gccttcttcaaggtctccgacccgaccaagctaagcaagcagaagaagcagcagcgtctt
gaacccttgtacaaccgctacgaggaacccaacgcttggagaatatcccgggccttccga
cggcgctga

DBGET integrated database retrieval system