KEGG   Acinonyx jubatus (cheetah): 106989578Help
Entry
106989578         CDS       T04657                                 

Definition
(RefSeq) epididymal secretory glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00480  Glutathione metabolism
aju00590  Arachidonic acid metabolism
aju01100  Metabolic pathways
aju04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106989578
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106989578
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    106989578
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     106989578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 106989578
NCBI-ProteinID: XP_026907690
Position
Unknown
AA seq 261 aa AA seqDB search
MPQKPLPACDWPARAWLVCQKAARVREIPASKTRTSHLGMTAQLPASSLFPLLLVGVMCM
NPKPPEKVKMDCYKDVKGTIYEYDALTLNGKEHIQFKQYAGKHVLFVNVATYCGLTAQYP
ELNALQDELKPWGLVVLGFPCNQFGNQEPGENSEILPGLKYVRPGRGYVPNFQLFEKGDV
NGKTEQKVFSFLKLSCPHPSEVLGSFRHISWEPVKVHDIRWNFEKFLVGPNGVPVMRWFH
QAPISTVRSDILEYLKQLKTK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgccccagaaacccctgccggcttgcgactggcctgcacgggcttggctagtgtgtcaa
aaggctgccagagtgcgggagatcccagcctccaagaccagaacctcacacctaggcatg
acggcacagttacctgcctcctccctcttccctcttctgctagtaggcgtcatgtgcatg
aatcccaagcccccagagaaggtgaagatggattgctacaaagatgtgaaaggcaccatc
tacgaatatgacgccctcactcttaatggaaaggaacacattcagttcaagcagtacgcg
ggcaagcacgtccttttcgtcaacgtggccacctactgcggtctgacagctcagtatcct
gaactgaacgcacttcaggacgagctgaagccctggggcctggtcgtgctgggctttccc
tgcaaccagtttgggaaccaggaaccaggagagaactcggagatccttccggggctgaag
tatgtgcgtccagggagaggatatgtaccgaatttccagctttttgagaaaggggatgtg
aatggcaaaacagaacagaaagtcttcagcttcttgaagctctcctgccctcacccctct
gaggtgctgggctctttcagacacatatcctgggagccggtaaaggtccacgacatccgc
tggaactttgagaagttcctggtggggcccaacggggtccctgtcatgcgctggttccac
caggctcccatcagcaccgtcagatcggacatcctggagtacctgaagcagctaaaaacg
aaatag

DBGET integrated database retrieval system