KEGG   Acinonyx jubatus (cheetah): 106989707Help
Entry
106989707         CDS       T04657                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC11
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aju04131]
    106989707
Enzymes [BR:aju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     106989707
Membrane trafficking [BR:aju04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106989707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 106989707
NCBI-ProteinID: XP_026929129
Position
Unknown
AA seq 333 aa AA seqDB search
MDLCGRSQRGALREASRKQASPRRWSRVNGWSWPLHTFQAVAWTMLFILAFASFGIFVPL
LPPNWNLVIYGVTGGLFCFYFVVHLLAVCIDPAETNVRLKNYLERVPTFDPSKHMRVIEN
QYCHLCEVTVSQKAKHCGACNKCVFDFDHHCKWLNNCVGGRIYRYFFCSLVSDSASLLCL
ITILLYIFIQYFVNPEVLRTHPLYEDVSKDTWLLFLPLFPVKTKTLVVLGIGVFVLLLSA
LSLLLLGHLLIFHLFLMFKKLSTYEYVTQNRCQKTPRVPAGRKELSFKISTPQVAGAPLL
HHLRYPGPGQRPVSPCSWDFSNTVLCFCVGTVL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggatctgtgcggccggagccagagaggggccctgcgggaagccagcaggaagcaggcc
tcgccccgccgctggtccagagtgaatggctggtcgtggcccctgcacaccttccaggcg
gtggcctggaccatgctgttcatcttggccttcgccagcttcggtatcttcgtccccttg
ctgccgcctaactggaacttggtcatctatggtgtgactggtgggcttttctgtttctac
ttcgtggtccacttgcttgctgtttgcatcgatcctgctgaaaccaacgtacggctcaag
aactacttggagcgcgtacccacttttgacccatccaaacacatgcgtgtcatcgagaac
caatattgccacctgtgtgaggtcaccgtgagccagaaggctaaacactgtggggcctgc
aacaagtgtgtctttgactttgaccaccattgcaaatggcttaacaactgtgtagggggc
aggatttacagatatttcttctgctccttggtctctgactcggccagcctgctctgcctg
atcaccatcctgctgtacatcttcatccagtactttgtcaacccggaggtgctgcgcact
catcccctctatgaagacgtctccaaggacacttggctgctgttccttcctttgttccct
gtaaagacgaagaccctggtggtcctgggcattggggtgttcgtcctgctgctgtccgcc
ctcagcctcctgctacttggacacctgctcatcttccacctcttcttaatgttcaagaag
ttgagcacgtatgagtatgtgacacagaaccgctgtcaaaagactccaagagttccagca
gggaggaaagagctgtccttcaaaataagcacgccacaggtagcgggtgcccctctgctt
caccatctgcgctatccgggcccggggcagcgcccagtgtcaccttgcagctgggacttc
tcaaacacagtcctttgcttctgtgttggcacagtcctctga

DBGET integrated database retrieval system