KEGG   Acinonyx jubatus (cheetah): 113596628Help
Entry
113596628         CDS       T04657                                 

Gene name
PUDP
Definition
(RefSeq) pseudouridine-5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    113596628 (PUDP)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     113596628 (PUDP)
Protein phosphatases and associated proteins [BR:aju01009]
 HAD phosphatases
  Other HAD phosphatases
   113596628 (PUDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 113596628
NCBI-ProteinID: XP_026906422
Position
Unknown
AA seq 231 aa AA seqDB search
MAASVPPPRPVTHLLFDMDGLLLDTERLYSVVFQEICDRYGKKYSWDVKSLVMGKKASEA
AQIIIDVLQLPMTKEELLEESQTKLKEVFSTAALMPGVERLIRHLRRHGVPLAVATSSSR
ASFDMKTGRHQAFFGLFDHIVLGDDPEVSNGKPHPDIFLVCAKRFSPAPPTHQCLVFEDA
PNGVDAALAAGMQVVMVPDRNLQRHLTSKATLVLDSLQDFQPELFGLPRYE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttccgtgcccccgccgcggcccgtcacccacctgctctttgacatggacggt
ctccttcttgataccgaacggctgtattcggtggtgttccaagaaatatgtgatcgctac
ggaaagaaatacagttgggacgtcaagtcccttgttatggggaagaaggcatcagaggcg
gcacagatcataatagacgtcctgcagctcccgatgaccaaagaggagctgctggaggaa
agccagacgaagttgaaagaggtgttctccacggccgccctgatgccaggggtggagaga
ctgattcgccatctgcgccggcacggcgtgcccctggccgtggccaccagctccagccgc
gcatcgtttgacatgaagaccggcagacaccaggccttcttcggcttgtttgaccacatc
gtgttgggggatgaccccgaagtgagcaacgggaagccacatcccgacatatttctagtc
tgtgccaagaggttttcccctgctccgcccacccaccagtgcctcgtctttgaagacgct
cccaacggcgtggacgcggcccttgcagccggcatgcaggtggtcatggttccagaccga
aatctgcagcgccatttgacgtccaaggccacgctggtgctggattccctgcaggatttc
cagcccgagctgtttggtttgccgcgctacgagtga

DBGET integrated database retrieval system