KEGG   Advenella kashmirensis: TKWG_01905Help
Entry
TKWG_01905        CDS       T02117                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aka  Advenella kashmirensis
Pathway
aka00071  Fatty acid degradation
aka00280  Valine, leucine and isoleucine degradation
aka00281  Geraniol degradation
aka00310  Lysine degradation
aka00360  Phenylalanine metabolism
aka00362  Benzoate degradation
aka00380  Tryptophan metabolism
aka00410  beta-Alanine metabolism
aka00627  Aminobenzoate degradation
aka00640  Propanoate metabolism
aka00650  Butanoate metabolism
aka00903  Limonene and pinene degradation
aka00930  Caprolactam degradation
aka01100  Metabolic pathways
aka01110  Biosynthesis of secondary metabolites
aka01120  Microbial metabolism in diverse environments
aka01130  Biosynthesis of antibiotics
aka01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TKWG_01905
   00650 Butanoate metabolism
    TKWG_01905
  Lipid metabolism
   00071 Fatty acid degradation
    TKWG_01905
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TKWG_01905
   00310 Lysine degradation
    TKWG_01905
   00360 Phenylalanine metabolism
    TKWG_01905
   00380 Tryptophan metabolism
    TKWG_01905
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TKWG_01905
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TKWG_01905
   00281 Geraniol degradation
    TKWG_01905
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TKWG_01905
   00627 Aminobenzoate degradation
    TKWG_01905
   00930 Caprolactam degradation
    TKWG_01905
Enzymes [BR:aka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TKWG_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AFK61031
UniProt: I3U7P3
Position
325527..326330
Genome map
AA seq 267 aa AA seqDB search
MGYQHIEVLDQDAIRTITLARAGARNAQSQALLDELDQAMREAAADQSVRVVIIGGEGDH
FSAGHDLKEAQASRADFSVEERWAYESLRYFDYCMRIWDFPKPVIARVQGACVSGGFMIA
NMCDLVVCSDDAFFSDPVCHTLAAAATEVLIHPWVMGLRRAKEMLFTGERVTADQALQMG
MVNRVVSRAQLNEETMALARRVAAAPPFALTLVKKSLNRTLDAQGLRTALSAHFDVHQLS
HMSDEFAQVKKKGLAQAIQRNKSGDSA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgggctatcagcatatagaggtattggatcaggacgccatacggacgataacattggcg
cgggccggggcacgcaatgcgcagagccaggcgctgctggatgaactggatcaggccatg
cgcgaggccgcagctgatcagtctgtcagggtcgtgattattggcggcgaaggtgaccat
ttttctgccggtcatgatttgaaggaagcccaggccagccgtgccgacttcagcgtggaa
gagcgctgggcctacgagtctttgcgctattttgattactgcatgagaatctgggatttt
cccaagccggtcatcgcccgggtgcaaggggcctgcgtgtccggcggcttcatgatcgcc
aatatgtgcgatctggtggtctgttccgacgacgcatttttttccgatcccgtttgtcat
acgctggcggcggccgccaccgaggtcctgattcatccctgggtcatgggattgcgtcgg
gccaaggaaatgctgtttaccggcgagcgggtcaccgccgatcaggccttgcaaatgggc
atggttaaccgcgttgtctcgcgtgcgcagttgaacgaggaaaccatggcgctggcgcga
cgggttgccgcggcgccgccgtttgcccttacgctggtaaaaaaatccctgaatcggacg
ctggatgcccagggtctgcgtaccgcactttctgctcattttgacgtccatcagctttcg
catatgagcgatgagtttgcccaggtcaagaaaaaaggtctggcccaggcgatccagcgt
aacaaaagtggtgatagtgcatga

DBGET integrated database retrieval system