KEGG   Advenella kashmirensis: TKWG_03375Help
Entry
TKWG_03375        CDS       T02117                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
aka  Advenella kashmirensis
Pathway
aka00670  One carbon pool by folate
aka01100  Metabolic pathways
aka01120  Microbial metabolism in diverse environments
aka01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aka00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TKWG_03375
Enzymes [BR:aka01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     TKWG_03375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AFK61268
UniProt: I3U8D0
Position
581321..582163
Genome map
AA seq 280 aa AA seqDB search
MSSFSDEAFSLEFFPPRDQVSRERLVGTAKQLMAMHPRYISVTFGAGGSTRDGTAETVSM
FSQLGCEAAPHLSCIGASRASLIQLLDQYKAKGIHRIVALRGDLPSGMGGNDSELPYASE
LVRLIREHSGDWFHVEVAAYPEMHPQADSPEHDLDNFVTKVNAGANSAITQYFFNADAYF
DFVDRAVQRGVSIPIVPGIMPITNHTQLLRFSQMCGAEVPRWIRLRLAQYGDDKASIRAF
GADVVTQLCQKLIDGGVPGIHFYTLNNAEATLAIWKNLRY
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttttccgacgaggcattcagcctggagtttttcccgccgcgcgatcaggta
tcgcgcgagcggctggtaggcaccgccaagcagttgatggcgatgcatcctcgttatata
agtgtgactttcggggcaggcggctctacccgggatggaacggccgagaccgtctccatg
ttctcgcaactcggttgcgaggccgccccgcacctgtcctgcattggcgccagcagagcg
tcgctgatccaattgctggatcagtacaaggccaaaggcattcatcgcatcgtggcgttg
cgtggcgatctgccctcgggcatgggcggcaatgattcagagttaccgtatgcgtccgaa
ctggtcaggcttattcgcgaacattcgggcgattggtttcatgttgaagtggctgcctat
ccggaaatgcacccgcaggccgacagtcccgagcatgatctggataattttgtcaccaag
gtcaatgccggtgccaatagtgcgatcacgcagtattttttcaatgccgacgcctatttc
gattttgttgatcgtgccgtgcagcgtggcgtgagtattccgatcgtgccaggaatcatg
ccgattaccaaccatacgcagttgctgcggttctcgcaaatgtgcggtgccgaagtgccg
cgctggattcgcctgcgcctggcgcaatatggcgatgataaagcttccattcgtgccttt
ggtgccgatgtggttacccagctgtgtcagaagctgattgacggcggtgtgccgggcatt
catttttatacgcttaataatgccgaagccacgctggcgatatggaaaaatctgcgctat
tga

DBGET integrated database retrieval system