KEGG   Advenella kashmirensis: TKWG_03395Help
Entry
TKWG_03395        CDS       T02117                                 

Definition
(GenBank) putative aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
aka  Advenella kashmirensis
Pathway
aka00130  Ubiquinone and other terpenoid-quinone biosynthesis
aka00627  Aminobenzoate degradation
aka01100  Metabolic pathways
aka01110  Biosynthesis of secondary metabolites
aka01120  Microbial metabolism in diverse environments
aka01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aka00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    TKWG_03395
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TKWG_03395
Enzymes [BR:aka01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     TKWG_03395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein NAD_binding_10 NmrA
Motif
Other DBs
NCBI-ProteinID: AFK61272
UniProt: I3U8D4
Position
complement(586333..586926)
Genome map
AA seq 197 aa AA seqDB search
MPSSVSTPARIIVGITGASGAIYGVRALELLAQAGFETHLVMSRSASLTLSQELQMHPGE
LADRATVVHAIQDVGAVISSGSFKTSGMLIAPCSIRTLSEIASGVTSSLLTRAADVVLKE
RRKLVLMVRETPLHLGHLRSMVAVTEMGAIVMPPVPAFYARPESIQAMVDHSVGRALDLF
DIDTGSVTRWSGMSSNP
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccaagctccgtttccacacctgcacgtattattgtcggtatcaccggcgcctctggc
gccatttacggtgtccgtgctcttgagctgcttgcccaggccggcttcgaaacccatttg
gtcatgagccgctcggccagcctgaccttgtcgcaagagctgcagatgcatcccggtgaa
ctggccgaccgggcaacggtagtgcatgcgattcaggatgtaggggcggtcatttccagc
ggttctttcaaaaccagcgggatgctcattgctccttgttccattcgtacgctctcggaa
attgccagcggtgtcacctcttcgctattgacccgcgctgccgatgtggtgctcaaggaa
aggcgcaagctggtgcttatggtccgggaaacaccgctgcatctgggtcacttacgcagc
atggtggcggtaacggaaatgggcgccatcgtcatgccgccggtgccggctttttatgcg
cgcccggaaagtatccaggctatggtcgaccacagtgtcggtcgggcactggatctcttt
gacatagataccggttcggtcacccgctggagcggaatgagcagcaacccctga

DBGET integrated database retrieval system