KEGG   Advenella kashmirensis: TKWG_03445Help
Entry
TKWG_03445        CDS       T02117                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aka  Advenella kashmirensis
Pathway
aka00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aka01100  Metabolic pathways
aka01110  Biosynthesis of secondary metabolites
aka01130  Biosynthesis of antibiotics
aka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TKWG_03445 (trpC)
Enzymes [BR:aka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TKWG_03445 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NanE QRPTase_C DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AFK61280
UniProt: I3U8E2
Position
complement(594227..595021)
Genome map
AA seq 264 aa AA seqDB search
MNDILEQILSVKKEEVAMQRQFRSEADLLREAQARKDVRGFANALREKIRQKKTAVIAEV
KKASPSKGVIRPNFNPAEIAHTYAAHGATCLSVLTDVQFFQGSSDYLRQARAACPLPVLR
KDFMIDPYQIINARALGADCILLIVAALPADQLKEMEAVAQELDMDVLIEVHDRAELDIA
LDMKSSLIGINNRNLRTFETTLQTTLDLLPHIPEGRFVITESGIHAPEDVRSMHENGVYG
FLIGEAFMRETDPGITLESFIVNH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatattcttgaacagattctcagcgtaaaaaaagaagaagtcgctatgcagcgc
cagttccgcagcgaagcagatctgctgcgcgaagcccaggcgcgcaaggatgtgcgcggt
tttgccaatgcgctgcgtgaaaagatcagacagaaaaaaacggctgtcatcgctgaagta
aaaaaagcgtcgccatcaaaaggcgtaatccggcccaatttcaaccctgccgaaatcgcc
cacacctatgccgcccatggcgcgacgtgtctgtcagtgctgaccgatgtgcagtttttc
cagggctccagcgattatctgcgccaggcgcgcgcggcctgcccgctaccggtgctgcgc
aaagacttcatgattgatccctatcagatcatcaatgcccgcgcactgggcgccgactgc
atcctgctgatcgtcgccgctttgccggccgaccagctcaaggaaatggaagcggttgcg
caggaactggacatggatgtcctgatcgaggtgcacgaccgggccgaactggatatcgcc
ctggacatgaaatcgtcgctgatcggcatcaataaccgcaatctgcgcaccttcgagact
accttgcaaaccacgctggacctgctgccgcatattcccgaggggcgttttgtcattacc
gaaagcggcatccacgcccccgaggacgtgcgcagcatgcatgagaacggagtctatggg
ttcctgatcggcgaagcgttcatgcgggaaaccgatccaggcatcacacttgagtcattt
atcgtgaatcattga

DBGET integrated database retrieval system