KEGG   Advenella kashmirensis: TKWG_04750Help
Entry
TKWG_04750        CDS       T02117                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aka  Advenella kashmirensis
Pathway
aka00010  Glycolysis / Gluconeogenesis
aka00260  Glycine, serine and threonine metabolism
aka00680  Methane metabolism
aka01100  Metabolic pathways
aka01110  Biosynthesis of secondary metabolites
aka01120  Microbial metabolism in diverse environments
aka01130  Biosynthesis of antibiotics
aka01200  Carbon metabolism
aka01230  Biosynthesis of amino acids
Module
aka_M00002  Glycolysis, core module involving three-carbon compounds
aka_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKWG_04750 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    TKWG_04750 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TKWG_04750 (gpmA)
Enzymes [BR:aka01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TKWG_04750 (gpmA)
Membrane trafficking [BR:aka04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TKWG_04750 (gpmA)
Exosome [BR:aka04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TKWG_04750 (gpmA)
  Exosomal proteins of melanoma cells
   TKWG_04750 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFK61474
UniProt: I3U8Y6
Position
821428..822180
Genome map
AA seq 250 aa AA seqDB search
MYKLVLMRHGESQWNLENRFTGWKDVDLTETGRQQAWEAGELLKKEGYTFDLAFTSVLKR
AIRTLWIALDAMDAMYTPVHPSWRLNERHYGALQGLNKAETAQKYGDEQVLVWRRAYAIA
PEPLDGDDERHPRFDARYSRIAPADLPATECLKDTVERVLPLWNDSIAPAIKAGRNVLIS
AHGNSLRALIKHLDQVSEDDIVNLNIPTGQPLVYELDENLKPIKHYYLGDQEAIAAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtataagctagtgttaatgcgccatggcgaaagccagtggaatcttgaaaaccggttt
accggctggaaagacgtcgatctgactgaaaccggccgtcagcaggcctgggaagccggc
gagctgctcaaaaaagaaggctacaccttcgatctggcattcacatctgtgttaaaacgc
gccatccgcaccctctggattgcgctggatgccatggatgccatgtacacgcctgtgcat
ccgagctggcgcctgaatgaacggcactatggcgcgttgcagggcctgaacaaggcggaa
acggcgcagaaatatggcgatgagcaggtgctggtatggcgccgggcttatgccattgcg
cccgagccgctggacggtgatgacgaacgtcatccgcgctttgatgcgcgctatagccgc
attgccccagccgatctgcccgcaaccgaatgcctgaaagataccgtggagcgggtcctg
cctttatggaatgactctattgcgccggcgatcaaggccggtcgcaatgtgcttatttca
gctcacggcaatagcctgcgtgcgttgatcaagcatctggatcaggtctccgaagacgat
atcgtcaatctgaatatccctaccggccagccgctggtctatgagctcgatgagaacctc
aagcctatcaagcactactatctgggcgatcaggaagccatcgctgcggccatggctgct
gttgcggcccagggaaaggctaaaaaggactga

DBGET integrated database retrieval system