KEGG   Advenella kashmirensis: TKWG_06020Help
Entry
TKWG_06020        CDS       T02117                                 

Definition
(GenBank) nitrate transporter NrtA
  KO
K15576  nitrate/nitrite transport system substrate-binding protein
Organism
aka  Advenella kashmirensis
Pathway
aka00910  Nitrogen metabolism
aka02010  ABC transporters
Module
aka_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:aka00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    TKWG_06020
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    TKWG_06020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aka02000]
    TKWG_06020
Transporters [BR:aka02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438]
    TKWG_06020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1_2
Motif
Other DBs
NCBI-ProteinID: AFK61665
UniProt: I3U9H7
Position
1035943..1037274
Genome map
AA seq 443 aa AA seqDB search
MNSRKKTDATGNSDGVRSRKQAAQDAIAPGSVYRRQWMLSVARSAAGMGALGLADPFLRH
GAWAAGSDAPEKTEVRIGFIPLTDCASVIMAAELGIDKKYGIKIIPSKEASWAAVRDKLI
NGNLDCAHALYGMIYGLQVGIGGPQTDMAVLMGLNQNGQGITLAKALHERGVSDGASLKK
AMATLDRQLTFAQTFPTSTHAMWLYYWLAAHDIHPFNDVRVITVPPPQMVANMMIGNMDG
YCVGEPWNARAVIDKIGFTAVTTQEIWQDHPEKVLGTTARFADQYPNTARAVTAAILEAG
RWIDSSPANIEQTAKVIAAKSYVNTQADVIIGRMLGKYDNGIGKIADSAHPMRFYGNGAA
TFPYLSDGMWFLTQQKRWGLLKSHPDYLAVAKKINRIDIYKAAAQASGTPLPASENRSST
LIDGVLWDGSDPAAYADSFAVHV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtcggaagaaaacggacgcaacaggcaattcggacggggttcgttcccgcaag
caggcggcacaggacgccattgcgccgggcagcgtgtatcggcggcaatggatgctgtca
gtggcgcgctcggctgcaggcatgggtgcacttggcctggcagatccctttttgcgccat
ggcgcctgggccgccgggtcggacgcaccggaaaagaccgaggtcaggatcggcttcatt
cccctgaccgactgcgcctcggtgatcatggcggccgagctgggcatcgacaaaaaatac
ggaataaagattattccgagcaaggaagcgtcctgggccgccgtgcgtgacaagctcatc
aatggcaatctggactgcgcgcatgcattgtacggcatgatttacggcctgcaggtgggg
attggtggtccgcaaaccgacatggccgtgctcatggggctgaatcagaacgggcagggc
attacgcttgccaaggcattgcacgagcgcggcgtatcagacggcgcatcactgaaaaaa
gccatggcaacgctggatcggcaactgaccttcgcacaaacctttcccaccagcacgcat
gccatgtggctttattattggctggctgcgcatgatattcatccatttaacgatgttcgt
gtcattaccgtgccaccgccgcaaatggtggccaatatgatgatcggcaatatggatggg
tactgcgtgggtgaaccatggaacgcgcgggcggtgatcgataaaattggctttaccgcc
gtgactacacaggaaatttggcaggatcatccggaaaaagtgctgggtaccacggcccgg
tttgcagaccagtatcccaataccgccagggctgtgacggcagccattcttgaagccggc
cggtggatcgacagctcgccggccaatattgagcaaacggccaaggtgattgccgccaag
tcctatgtcaacacgcaggccgatgtgattatcggccgcatgctgggcaagtacgacaac
ggcatcggcaagattgcagacagcgcgcatcccatgcggttttatggcaacggggcagca
acctttccttatctgagtgatggcatgtggttcctgacccagcaaaagcgctggggcttg
ctcaaatcgcatcccgactatctggctgtggcaaaaaaaatcaatcgtatcgacatctac
aaggcggccgcccaggccagtggcacgccgttgccggccagcgaaaaccgttcttcgacg
ctgatcgatggcgtgctttgggatggcagcgatccggcggcctatgccgacagctttgcc
gttcatgtgtaa

DBGET integrated database retrieval system