KEGG   Advenella kashmirensis: TKWG_16020Help
Entry
TKWG_16020        CDS       T02117                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
aka  Advenella kashmirensis
Pathway
aka00630  Glyoxylate and dicarboxylate metabolism
aka00710  Carbon fixation in photosynthetic organisms
aka01100  Metabolic pathways
aka01110  Biosynthesis of secondary metabolites
aka01120  Microbial metabolism in diverse environments
aka01130  Biosynthesis of antibiotics
aka01200  Carbon metabolism
Module
aka_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aka_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:aka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TKWG_16020
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TKWG_16020
Enzymes [BR:aka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TKWG_16020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFK63175
UniProt: I3UDT7
Position
2760833..2761252
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLTNEQITKQLQYCLDNGWAVGIEYTDDPHPRNTFWEMFGNPMFDLRD
AAGILQEIEQARNTFPNHYIRVTAFDSTHTVESVVMSFIVNRPAHEPGFRLVRQEIDGRR
MRYTIESYAVAAAPEGSRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattacacaaggcaccttctcgtttctacctgatctgaccaacgaacagatcacc
aaacaactgcagtattgcctggacaacggctgggccgtcggcattgaatataccgatgat
ccgcatccgcgcaacactttctgggaaatgttcggcaatcccatgttcgatctgcgcgat
gccgccggcatattgcaggagatcgaacaggcacgcaataccttccccaatcactatatc
cgggtcaccgcgttcgattccactcataccgtagagtctgtggtgatgtcattcatcgtc
aaccgtcccgcccatgaaccaggctttcgtctggttcgccaggaaatcgacggacgacgc
atgcgctacacgattgaaagctatgccgttgcggcagctccagaaggcagccgctattga

DBGET integrated database retrieval system