KEGG   Advenella kashmirensis: TKWG_17175Help
Entry
TKWG_17175        CDS       T02117                                 

Definition
(GenBank) nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
aka  Advenella kashmirensis
Pathway
aka00760  Nicotinate and nicotinamide metabolism
aka01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TKWG_17175
Enzymes [BR:aka01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TKWG_17175
    3.5.1.-  
     TKWG_17175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase DUF3197 Glyco_hydro_11
Motif
Other DBs
NCBI-ProteinID: AFK63349
UniProt: I3UEB1
Position
2961627..2962256
Genome map
AA seq 209 aa AA seqDB search
MTNSILPHSALILVDIQPDFMPGGPLACEQADAIVRPVQALLAQDCFAHYVATQDWHPSG
HISFASSHTGRKPFDSIELYGHPQVLWPDHCVQGTNGAALHSAIDWNRMNVILRKGADPA
VDSYSAFCENHNPAGERPLTGLAGWLKDRQVRNVYIGGLARDVCVLWSAQDAQAAGFNTF
VIWDATAPVTAQTDADTRKTLLAQGIRIV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatagcatattgcctcatagcgcgcttattctggtcgatatccagccggacttc
atgcccggtggcccgctcgcatgtgaacaggcagatgccattgtgaggcctgtacaggcc
ttactggcgcaggactgttttgcccattatgtcgccacccaagactggcatccaagtggc
catatttcctttgcatcctcgcacaccggccgtaaaccctttgacagtattgagctttac
ggccatcctcaggtgctatggcctgatcactgcgtacagggaacaaacggtgcggccttg
catagtgccatcgactggaacaggatgaatgtcatattacgcaaaggcgccgatcccgct
gtggactcgtacagcgcgttttgcgaaaaccacaaccctgcaggcgaacgtccattgacc
ggtcttgccggctggctgaaggatcgccaggtgcggaatgtatatattggcggcctggca
agagatgtgtgcgtattatggtccgcgcaggacgcacaggcggctggtttcaatacattt
gtcatttgggacgcgaccgccccggttaccgcccaaaccgatgcagatacgcgcaagacc
ctgctggcacagggcatccgcatcgtgtaa

DBGET integrated database retrieval system