KEGG   Advenella kashmirensis: TKWG_17440Help
Entry
TKWG_17440        CDS       T02117                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aka  Advenella kashmirensis
Pathway
aka00071  Fatty acid degradation
aka00072  Synthesis and degradation of ketone bodies
aka00280  Valine, leucine and isoleucine degradation
aka00310  Lysine degradation
aka00362  Benzoate degradation
aka00380  Tryptophan metabolism
aka00620  Pyruvate metabolism
aka00630  Glyoxylate and dicarboxylate metabolism
aka00640  Propanoate metabolism
aka00650  Butanoate metabolism
aka00900  Terpenoid backbone biosynthesis
aka01100  Metabolic pathways
aka01110  Biosynthesis of secondary metabolites
aka01120  Microbial metabolism in diverse environments
aka01130  Biosynthesis of antibiotics
aka01200  Carbon metabolism
aka01212  Fatty acid metabolism
aka02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TKWG_17440
   00630 Glyoxylate and dicarboxylate metabolism
    TKWG_17440
   00640 Propanoate metabolism
    TKWG_17440
   00650 Butanoate metabolism
    TKWG_17440
  Lipid metabolism
   00071 Fatty acid degradation
    TKWG_17440
   00072 Synthesis and degradation of ketone bodies
    TKWG_17440
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TKWG_17440
   00310 Lysine degradation
    TKWG_17440
   00380 Tryptophan metabolism
    TKWG_17440
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TKWG_17440
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TKWG_17440
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TKWG_17440
Enzymes [BR:aka01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TKWG_17440
Exosome [BR:aka04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TKWG_17440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFK63393
UniProt: I3UEF5
Position
complement(3007842..3008561)
Genome map
AA seq 239 aa AA seqDB search
MREAVIVSTARTGLAKSWKGAFNMTYGATLGAHSVSHAVARAGIDVAEVEDVIMGSALPE
GTTGGNIARAIALRAGLPIGAGGVTVNRFCSSGLQAIAMAAQRIIVDQVPVLVAGGVESI
SCVQNDANTLMRQDPWLRQHKPELYWSMLQTAETVAKRYGISREAQDEYGARSQQRAARA
QAEGLFNDEIVPMTTVMSVFDKATGGIARREVTIAADEGIRPDTTLEACRKFGRFSPRA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagtaatcgtttcaaccgcccgtaccggactggcaaagtcctggaagggt
gcattcaatatgacctatggcgcaacgctgggggcgcattcggtgtcgcatgccgttgcg
cgtgccggtattgacgtggctgaagtggaagatgtcatcatggggtcggccttgcctgaa
ggcacgaccggcggcaatattgcacgggccattgccttgcgtgccggtctgccgatcggt
gcaggtggtgtgaccgtcaaccggttttgctcgtcggggttgcaggcgatcgccatggcg
gcacagcgcattattgttgaccaggttccggtgctggtggccggcggcgtcgaaagtatt
tcctgcgtgcaaaatgatgccaacacactcatgcgccaggacccctggctacgtcaacat
aaacccgaactgtactggagcatgttacagactgcggaaaccgtcgccaagcgctatggc
atttcgcgcgaggcacaggacgaatatggcgcccgcagccagcagcgtgccgcccgggcc
caggctgaaggcctgttcaatgacgaaattgtgcccatgacaacggtcatgagcgttttt
gacaaggcaaccggcggcatcgcccgtcgtgaggtaaccattgctgcagatgaaggcatc
cgtcccgataccacgctagaggcgtgtcgaaaattcggccggttttccccaagggcgtga

DBGET integrated database retrieval system