KEGG   Advenella kashmirensis: TKWG_22960Help
Entry
TKWG_22960        CDS       T02117                                 

Definition
(GenBank) 2-keto-3-deoxygluconate permease
  KO
K02526  2-keto-3-deoxygluconate permease
Organism
aka  Advenella kashmirensis
Brite
KEGG Orthology (KO) [BR:aka00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aka02000]
    TKWG_22960
Transporters [BR:aka02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   TKWG_22960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdgT
Motif
Other DBs
NCBI-ProteinID: AFK64204
UniProt: I3UGR6
Position
complement(3939865..3940890)
Genome map
AA seq 341 aa AA seqDB search
MMTQERSIFPMFQTMQKIPGGLMLIPLILGSILGTFAPEALGIGSFTTALFKNSALPLIA
LLIFATGTQVNMRTGGPILATAGTILFCKTLIPASLIVLLGSFVGIDGVWGISILALLAA
FDNSNGGLWLAFTGQYGDARDRGAYVASAVNDGPFFSLLFLGASGLGDIPLIALVAALVP
FLLGVLVGNLDVQWRKVLDPVPNIVIPFFAFALGTGINLSAIVSGGTTGIILGFLISPIT
GFLVYMGYKFILRRGGKSGIGFAAGTTAGNAIATPAIVAAADPRFQVYVETATAQVAACV
LISSIMAPLLASYFLKKSGELKPVDDGISGVAETAGEPAKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatgacacaagagcgttcaatatttcccatgttccaaaccatgcagaaaatccctggt
ggattgatgcttattcccctgattctgggttcgatactggggacatttgcccccgaagcc
cttggcatcggcagtttcaccactgcgttgtttaaaaacagcgccttgccgctgattgca
ttgctgattttcgctaccggtacgcaggtcaatatgcgcaccggcggcccgatcctggca
actgcgggcaccattcttttttgcaaaacgcttattccggccagcctgattgtgctgctg
ggcagctttgttggtattgacggcgtgtggggaatctctatcctggcactgctggctgca
ttcgataacagtaacggcggcctgtggctggcgtttaccgggcagtatggcgatgcccgg
gatcggggcgcctatgtggccagcgccgtgaacgacggaccgtttttcagtctgctgttc
ctgggcgcttcgggtctgggcgatattcctttaatcgcgcttgtcgcggcgttggtgccg
ttcctgctgggcgtgctggttggtaaccttgacgtgcaatggcgcaaggtgctggatccc
gtgcctaatattgtgatcccgttttttgcctttgcactgggtaccggcatcaacctgtcg
gcgatcgtcagtggcggcacgaccggcattattctgggctttctgatcagtcccattacc
ggcttcctggtttacatggggtacaagttcatcctgcgacgcggcggaaaaagcggtatt
ggctttgctgccggcacgaccgctggcaatgcgattgcaacaccggccattgttgcggcg
gccgatccacgctttcaggtctatgttgagaccgcgactgcacaggttgcggcatgcgtg
ctgatcagctcaatcatggcccccttgctggcttcttatttcctgaaaaaatccggtgaa
ttaaagccggtagatgatggtatctcgggcgttgctgagactgccggggaacctgcgaag
ttatga

DBGET integrated database retrieval system