KEGG   Advenella kashmirensis: TKWG_23305Help
Entry
TKWG_23305        CDS       T02117                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K16843  (S)-sulfolactate dehydrogenase [EC:1.1.1.310]
Organism
aka  Advenella kashmirensis
Pathway
aka00270  Cysteine and methionine metabolism
aka01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aka00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TKWG_23305
Enzymes [BR:aka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.310  (S)-sulfolactate dehydrogenase
     TKWG_23305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C DUF5070
Motif
Other DBs
NCBI-ProteinID: AFK64258
UniProt: I3UGX0
Position
3997351..3998286
Genome map
AA seq 311 aa AA seqDB search
MTNTIVISEFMDEPAVERLRQIAQVDYRPELVDNQEALLQSLANATALIVRNRTQVNAQL
LAHAPRLQVVGRLGVGLDNIDMDLCADKGITVYPAVGANAQAVAEYVIATTFVLLRGAYL
ASAQVTAGKWPRPQLSNGLEVAGRTLGLVGFGGIGQLTARLASALGMKIAAYDPMINSDS
PIWAGTGAMQMSLDELLQHSDVVSLHTPLTKETRHLINASRIARMKAQAVLINTSRGGIV
DEQALVAALQAGKLLGAALDVFEDEPVKAKNSLPDMPNLILTPHIAGLTQEANERVSGVI
AEKVMGYLEGK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacacaattgtcatctctgaatttatggatgaaccggcagtagagcgcctgcgc
cagatcgcacaggtggactatcggccggaacttgtagacaaccaggaagcattgcttcaa
agtctggccaatgccactgccctgatcgtacgcaatcgcacccaggttaatgcccaactg
ctggcgcacgcccccaggctgcaggtggtgggccgcctgggcgttggcctggacaatatc
gatatggacctgtgcgcagacaaaggcatcaccgtttacccggccgtaggcgccaatgca
caggcagttgccgagtatgtgattgcaaccacattcgtgctgctgcgaggcgcttatctg
gccagtgcccaggtaacagccggcaaatggccgcgcccccaactcagtaatggtctggag
gtggcaggacgtacgctcggcctggtgggcttcggcggcataggccagcttaccgccagg
ctggcaagcgcactgggcatgaagatcgccgcatacgatcccatgatcaactcagacagc
cctatctgggccggcaccggcgcaatgcaaatgtcattggacgaattgttgcaacacagt
gacgttgtgagcctgcataccccgttgacaaaggagacccgccatctgatcaatgccagc
cgcattgccaggatgaaagcgcaagccgttctgatcaatacctcacgcggtgggattgtg
gatgagcaggcattggtggcggccctgcaggccggcaaactgctcggcgcagcgctggat
gtctttgaggatgagccggtaaaggcgaaaaacagtctgccggatatgccaaacctgata
ttgacgccacatattgccggattaacgcaagaagccaatgagcgggtgtcgggggtgatt
gcggagaaagtgatggggtatttagaggggaaatga

DBGET integrated database retrieval system