KEGG   Advenella kashmirensis: TKWG_23565Help
Entry
TKWG_23565        CDS       T02117                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
aka  Advenella kashmirensis
Brite
KEGG Orthology (KO) [BR:aka00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aka02044]
    TKWG_23565
Secretion system [BR:aka02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TKWG_23565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: AFK64306
UniProt: I3UH18
Position
complement(4058231..4058785)
Genome map
AA seq 184 aa AA seqDB search
MSSRRSGQKFIARNRAPRVQIEYDVEIYGAERTIQLPFVMGVMADLAGKSEVPQADINDR
KFLEVDIDNFDERMKAIKPRVAFQVPNTLTGEGVLSVDMSFDSIDDFSPAQVARKVDALK
ELLEARTELANLLTYMDGKTGAEELINKVLKNPALMKTLAAAPNKDTSAPEADKPESDAD
DTSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcacgcagaagcggtcagaagttcattgcacgaaaccgcgctccgcgtgtgcag
atcgaatatgacgttgaaatctatggtgccgaaagaaccattcagttgccgtttgtcatg
ggcgtcatggccgatcttgccggtaaatccgaagtgccgcaggccgatatcaacgaccgc
aaatttcttgaagtagacatcgataatttcgatgaacgcatgaaggccatcaagccgcgc
gtggcgtttcaggttcccaacaccctgaccggcgaaggtgtgctcagtgtggacatgagc
tttgacagcatcgacgatttttcaccggcacaggtggcgcgcaaggtcgatgcgcttaaa
gaattgctggaagcgcgtactgagctggccaatctgctgacctatatggatggcaaaacc
ggcgccgaagaactcatcaacaaggtactgaagaacccggccttgatgaaaacgctggca
gcagcgccgaacaaggatacatctgcccccgaggctgacaagcctgaatccgacgcagac
gacaccagtaagtaa

DBGET integrated database retrieval system