KEGG   Acinetobacter larvae: BFG52_01390Help
Entry
BFG52_01390       CDS       T04708                                 

Definition
(GenBank) propionyl-CoA--succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
ala  Acinetobacter larvae
Pathway
ala00020  Citrate cycle (TCA cycle)
ala00620  Pyruvate metabolism
ala00650  Butanoate metabolism
ala01100  Metabolic pathways
ala01110  Biosynthesis of secondary metabolites
ala01120  Microbial metabolism in diverse environments
ala01130  Biosynthesis of antibiotics
ala01200  Carbon metabolism
Module
ala_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ala_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BFG52_01390
   00620 Pyruvate metabolism
    BFG52_01390
   00650 Butanoate metabolism
    BFG52_01390
Enzymes [BR:ala01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BFG52_01390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF LUD_dom DUF4154
Motif
Other DBs
NCBI-ProteinID: AOA57134
UniProt: A0A1B2LW24
Position
complement(309683..311197)
Genome map
AA seq 504 aa AA seqDB search
MDLDRIRLTSLHNKVMSAEQAAQFIQDGMTVGMSGFTRAGEAKAVPQALVKQAQSNPLKI
TLITGASLGNDLDKQLTEAGVLARRLPFQVDNTLRRAINQGEVMFIDQHLSETVEQMRNM
QLKRPDVAVIEAVAITEDGGIIPTTSVGNSASFAIFAEQVIVEINTSLSPAFEGLHDIYI
PSYRPTRQPIPLTKVDQRIGTTAIQIDPSKIVGIVFNDSSDSPSTVTLPDDETQAIAQHL
IHFFENEVANDRLPANLGPLQAGIGSIANAVLTGLKDSNFSDLVMYSEVLQDCTFELIDA
GKMKFASGSSITLSAACGDKVFGNIEAYKDKLVLRPQEISNHPEIVRRLGIIGINTALEF
DIYGNVNSTHVCGTKMMNGIGGSGDFARNAHLAIFVTKSIAKGGDISSIVPMASHVDHSE
HDVDILVTEQGLADLRGLAPRERAKAIIDNCAHPLYRDALYDYFERSCEKGGHTPHILRE
ALAWHANFEETGHMLGTAKMAKTA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggatttagaccgcattcgtttaacatcactacataataaagtgatgagtgcagagcag
gcagctcaatttatacaagatggtatgactgttggtatgagtggctttacccgtgcaggt
gaagcaaaggctgttccacaagctctggtcaagcaagcacaaagtaatccgctcaaaatt
accctcatcacaggtgccagtctcggtaatgatctagacaagcaacttactgaagcaggt
gtacttgctcgtcgtcttccattccaagtcgacaatactttacgtcgtgccatcaatcag
ggtgaagtcatgttcatcgatcagcatctgtctgaaaccgttgaacaaatgcgtaatatg
caattaaaacgccctgatgtagctgtcattgaagcagtagcaattactgaagatggtggg
attattccaaccacatctgtagggaactctgcaagctttgcaatttttgctgaacaagtg
attgttgaaattaatacctcactgagcccagcatttgaaggtttacacgatatctacatt
ccgtcatatcgtccaacacggcaaccaattccgctaaccaaagtggatcaacgcattggt
accactgccattcaaatcgacccaagtaaaattgtcggcattgtatttaacgatagctcg
gattcaccgtctacggtcactttgccagatgatgaaacccaagccattgcacagcatctt
attcacttctttgaaaatgaagttgcaaatgatcgcctacctgccaaccttggtccgcta
caagctggtattggctctattgccaatgcggtgctcacaggcttaaaagactccaacttt
agcgacttggtgatgtattcagaagtattgcaagactgtacttttgaactgatcgatgcc
ggtaaaatgaagtttgcatcgggttcatctattaccttgtctgctgcatgtggagacaaa
gtctttggtaatatcgaagcctataaagataagctggtgttacgcccgcaagagatttct
aaccatccagaaatcgttcgtcgtctgggtattatcggcatcaataccgccttagaattt
gacatctatggtaacgtcaactctacccacgtatgtggtaccaaaatgatgaacggtatc
ggagggtcgggtgactttgcacgtaatgcacacttggctatttttgtgaccaaatctatt
gccaaagggggtgacatctcctcgatcgtgccaatggcgtcccatgttgaccatagcgaa
catgatgtcgatatcttagtgactgaacaaggtctagcagatttacgcggtctggcacca
cgtgaacgcgcaaaagcgattatcgataactgcgcacatccattgtatcgtgatgcacta
tatgattactttgagcgctcatgtgaaaaaggtggtcacacaccacatattctacgtgaa
gcccttgcttggcatgctaactttgaagaaaccggtcatatgctcggtacggctaaaatg
gcaaaaacagcataa

DBGET integrated database retrieval system