KEGG   Acinetobacter larvae: BFG52_03410Help
Entry
BFG52_03410       CDS       T04708                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ala  Acinetobacter larvae
Pathway
ala00071  Fatty acid degradation
ala00072  Synthesis and degradation of ketone bodies
ala00280  Valine, leucine and isoleucine degradation
ala00310  Lysine degradation
ala00362  Benzoate degradation
ala00380  Tryptophan metabolism
ala00620  Pyruvate metabolism
ala00630  Glyoxylate and dicarboxylate metabolism
ala00640  Propanoate metabolism
ala00650  Butanoate metabolism
ala00900  Terpenoid backbone biosynthesis
ala01100  Metabolic pathways
ala01110  Biosynthesis of secondary metabolites
ala01120  Microbial metabolism in diverse environments
ala01130  Biosynthesis of antibiotics
ala01200  Carbon metabolism
ala01212  Fatty acid metabolism
ala02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFG52_03410
   00630 Glyoxylate and dicarboxylate metabolism
    BFG52_03410
   00640 Propanoate metabolism
    BFG52_03410
   00650 Butanoate metabolism
    BFG52_03410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BFG52_03410
   00072 Synthesis and degradation of ketone bodies
    BFG52_03410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFG52_03410
   00310 Lysine degradation
    BFG52_03410
   00380 Tryptophan metabolism
    BFG52_03410
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BFG52_03410
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BFG52_03410
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BFG52_03410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ala04147]
    BFG52_03410
Enzymes [BR:ala01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BFG52_03410
Exosome [BR:ala04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BFG52_03410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOA57493
UniProt: A0A1B2LXJ9
Position
complement(768572..769747)
Genome map
AA seq 391 aa AA seqDB search
MTGIVIVNGARTAMGGFQGSLSAATAPQLGAAVIQAAVQRAGLQPTDVQEVIMGCVLPAG
LKQGPARQAMRLAGLPDQTGAVTINKLCGSGMKAVMQASDMIKAGSAEVVVAGGMESMSN
APYLLPKARGGYRMGHGEVKDHMFLDGLEDAETGRLMGSFAQDMANSREYSREQMDNFAI
RSLERAQTAIREGYFKDEIIPVTISTRKGDVVVDQDEQPFKANIEKIPQLKPAFAKDGTI
TAANASSISDGASALLLTSEHYAAEKGLQPLAKIVAYASNSQHPSEFTIAPVGAIEKVLK
QTGWNAQDVDLWEINEAFAMVTMCPIDDFKLDPAKVNIHGGACALGHPVGSTGSRIILTL
IHALKRIGGQKGIATLCIGGGEATAVAIELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactggcattgtgattgtaaatggtgcacgtactgcgatgggcgggtttcagggaagt
ttatccgccgcgactgccccacaactgggtgcagccgttattcaagctgcggtacagcgt
gctggactacagcctacagatgtacaagaagtgattatgggttgtgttcttcccgcaggt
ttaaaacaaggacccgcccgccaagcaatgcgtcttgctgggcttccagatcagacaggc
gctgtaaccattaacaaattgtgtggttcagggatgaaagcggtcatgcaagccagcgat
atgatcaaagctggctcagccgaggtcgtggttgctggtggcatggaatccatgagcaat
gccccttacctactgcctaaggcacgtggtggataccgtatgggacatggtgaagtgaaa
gatcatatgtttctagatggtttagaagatgcagaaacagggcgtttaatgggatctttt
gcccaagacatggccaatagccgtgaatatagccgcgaacaaatggataactttgcaatt
cgctcacttgaacgtgctcaaacagcgatacgtgaaggttatttcaaagatgagatcatt
cctgtcacgatcagcacgcgtaaaggcgatgtggtggttgatcaggatgagcaacccttt
aaagcaaatattgaaaaaattccacaactaaaacctgcctttgccaaagacggtaccatt
accgctgccaatgccagctccatttcagatggtgcatctgcgctgttgctcacatcagaa
cactatgcagcagaaaaaggtctacaacccttagccaaaatcgtggcttatgcttctaat
tcacaacatccatcagaatttaccattgctccagtgggtgcgattgaaaaggttttaaaa
caaaccggctggaatgcacaagatgttgatctatgggaaattaatgaagcctttgccatg
gtgaccatgtgcccaattgacgatttcaaattagacccagccaaagtcaatattcatggt
ggcgcatgtgcacttggacatcctgtaggatcaactggttcacggattatcttaaccttg
atccacgccttaaaacgcattggcggtcaaaaaggcattgcaaccctatgtatcggtggt
ggtgaagcaactgcagttgccatcgaattgctataa

DBGET integrated database retrieval system