KEGG   Acinetobacter larvae: BFG52_04945Help
Entry
BFG52_04945       CDS       T04708                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ala  Acinetobacter larvae
Pathway
ala00010  Glycolysis / Gluconeogenesis
ala00020  Citrate cycle (TCA cycle)
ala00620  Pyruvate metabolism
ala01100  Metabolic pathways
ala01110  Biosynthesis of secondary metabolites
ala01120  Microbial metabolism in diverse environments
ala01130  Biosynthesis of antibiotics
ala01200  Carbon metabolism
Module
ala_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFG52_04945
   00020 Citrate cycle (TCA cycle)
    BFG52_04945
   00620 Pyruvate metabolism
    BFG52_04945
Enzymes [BR:ala01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BFG52_04945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF5047 DUF1859
Motif
Other DBs
NCBI-ProteinID: AOA57768
UniProt: A0A1B2LXU2
Position
1112504..1113796
Genome map
AA seq 430 aa AA seqDB search
MSTLLHMPEVLANTTHATINKWLVAEGDQIVIGQCIAEVETDKAVVEMVAEAEGLISKII
VPEGEEVEVGAAIAQLNGDGQVDLATVAANTSPVAADVISENRLVSTPSTEHGQTATPLT
GDIDPSAASTRIFASPLAKRLAKQHQLDLAALSGSGPRGRIVKRDIEMALEHALAQLAAT
PATTVPEQPSLAGTAIAGDQVAGDQAYEDIPLSNMRKTIARRLTESKSTVPHFYLNVQCQ
VDALLALRQQINAIATEKISVNDLVIKAVALASQQVPAMNACWAETAIRQYKHVDISVAV
ATEKGLLTPVIRQAEHKSLSTIHREVANLAELARAGKLAPEQYQGGSFSISNLGMFGVSD
FNAIINPPQAGILAVGAIQKAAVVVDDALTIASVLRCSLSADHRVVDGAVAATWLAAFKQ
LIEDPLKLLI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgttattgcatatgccagaagttttggcaaataccacccatgccaccatcaat
aaatggttggttgcagaaggtgatcaaattgtgattgggcaatgtattgccgaagttgaa
accgataaagccgtggtggaaatggtggctgaagcggaaggcttgatcagtaaaattatt
gtgccagaaggtgaagaagttgaagtcggggcggcaattgcgcaactgaatggtgatggt
caagttgatctcgcgacagttgcagcgaacacatcgcccgtagcagctgacgtgattagc
gagaatcgactggtcagtacgcccagcaccgagcatggacaaactgctacgccattgact
ggcgacattgatccaagtgctgcgtcaacacgtatttttgcttctcctttggcgaaacga
ctcgccaagcaacatcagttagatctcgccgcactgtctggcagtggaccacgtgggcgt
attgtaaaacgtgatattgaaatggcacttgagcatgcccttgctcagcttgcagccaca
ccagcgaccacagtacccgagcagccgagtcttgccggtacagctattgccggggatcaa
gttgcgggtgatcaagcttatgaagatattccgttgagcaatatgcgtaaaaccattgca
agacgcttaaccgagagtaaatcgacagtgccacatttttatttaaatgtgcagtgtcag
gtcgatgcactattggcattgcgtcaacaaataaatgccattgctacagaaaaaatttct
gtcaatgacttggtgattaaagcggtagccttggcttcacagcaggtacccgccatgaat
gcctgttgggcagagaccgctatacgccaatataaacatgtggatattagtgtggctgtc
gcaacagaaaaaggtttactcacgcccgtgatccgtcaagccgaacacaaatcactgtcg
acgattcatcgtgaagtggcaaatttggctgaattggcacgtgcgggcaaattggcacct
gagcagtatcaagggggaagctttagtatcagtaaccttggcatgtttggggtgtcggat
tttaatgccattatcaatccgccgcaggcaggcatattggcagttggtgcgatacagaaa
gcagcagttgtggtggatgatgccttaaccatcgcgtcggttttgcgctgtagcttgtcg
gcagatcatcgtgtggtggatggtgcggtggcggcgacatggttggctgcttttaagcag
ctgatcgaagatccactgaagttactgatctaa

DBGET integrated database retrieval system