KEGG   Acinetobacter larvae: BFG52_06315Help
Entry
BFG52_06315       CDS       T04708                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ala  Acinetobacter larvae
Pathway
ala00071  Fatty acid degradation
ala00072  Synthesis and degradation of ketone bodies
ala00280  Valine, leucine and isoleucine degradation
ala00310  Lysine degradation
ala00362  Benzoate degradation
ala00380  Tryptophan metabolism
ala00620  Pyruvate metabolism
ala00630  Glyoxylate and dicarboxylate metabolism
ala00640  Propanoate metabolism
ala00650  Butanoate metabolism
ala00900  Terpenoid backbone biosynthesis
ala01100  Metabolic pathways
ala01110  Biosynthesis of secondary metabolites
ala01120  Microbial metabolism in diverse environments
ala01130  Biosynthesis of antibiotics
ala01200  Carbon metabolism
ala01212  Fatty acid metabolism
ala02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ala00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFG52_06315
   00630 Glyoxylate and dicarboxylate metabolism
    BFG52_06315
   00640 Propanoate metabolism
    BFG52_06315
   00650 Butanoate metabolism
    BFG52_06315
  Lipid metabolism
   00071 Fatty acid degradation
    BFG52_06315
   00072 Synthesis and degradation of ketone bodies
    BFG52_06315
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFG52_06315
   00310 Lysine degradation
    BFG52_06315
   00380 Tryptophan metabolism
    BFG52_06315
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BFG52_06315
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BFG52_06315
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BFG52_06315
Enzymes [BR:ala01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BFG52_06315
Exosome [BR:ala04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BFG52_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ORC6
Motif
Other DBs
NCBI-ProteinID: AOA58001
UniProt: A0A1B2LYJ4
Position
complement(1429037..1430575)
Genome map
AA seq 512 aa AA seqDB search
MSKSTQDNPTVEDASDQSLSNKSNVAPTASKRRRSPNAKTTSSTTSTTPRTGNRTSGSRN
ATAATTKTPRTRSTARASAKSAQENTMSHQAIRRVAIIGGNRTPFARSNGAYFKASNSDM
LTAALNGLIERYQLQGQRLGEVVAGAVLKHSRDFNMTRECVLSTKLAPETPAYDLQQACA
TGLQAAFTVANKIALGQIEVGIAGGVDTTSDAPIAFGDGLRKALLELNIAKTAKDRLKAL
SKINFKKLLDAPRNGEPRTSLSMGDHQALTALEWGISREAQDQLAVSSHHKMAKAYEEGF
FDDLITPFMGLERDNNLRPDSSIEKLAKLKPVFGKGDSATMTAANSTPLTDGASVVLLAS
EQWAKDNGHEILAYLSFSETSAIDFVGKKEGLLMAPTYAVPRMLERAKLKLQDFDYYEIH
EAFASQVLATLKAWEDPVFCKERLGLDAPLGSIDLNKLNVKGSSLAAGHPFAATGGRLLA
TAAKLLNEKGSGRVLISICAAGGQGVTAIVEK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatcaactcaagataatccgacagttgaagatgcaagcgaccaatctttgtca
aataaatcaaatgttgcaccaactgcatccaaacgtcgccgcagtccaaacgcaaaaacc
accagtagtaccacaagtacgacaccgcgcacaggtaaccgtacttcaggttctcgcaat
gcgactgccgcgaccactaaaacaccaagaaccagatcaactgctcgagcttcagcaaaa
tctgcacaggaaaatactatgagccatcaagctatacgccgtgttgcgatcattggcgga
aaccgtacaccttttgcccgttctaacggggcttacttcaaagccagcaatagtgacatg
ctcactgctgcattaaatggcttaattgaacgctaccaattacaaggtcaacgtttaggt
gaagtggttgccggtgcagtactcaaacatagccgtgattttaatatgacacgtgaatgt
gtactcagcacaaaattagcacccgaaacacctgcttatgatctacaacaagcctgtgca
acaggtttacaagccgcctttaccgtggcaaataaaattgcattaggccaaatcgaagtc
ggtattgccggcggggtagatacaacatctgatgcacccatcgcctttggtgatggctta
cgtaaagcattattagaactcaatattgccaaaaccgccaaagaccgtctcaaagcatta
tctaaaattaactttaaaaaactattagatgcacctcgcaatggtgagccacgtaccagt
ttatcgatgggagaccatcaagcattaaccgcattagaatggggtatttctcgcgaagct
caagaccaattagcggtatcttcacaccacaaaatggcaaaggcttatgaagaagggttc
tttgatgatctcatcaccccatttatgggcttagaacgcgataacaacttacgcccagat
tcatcgattgaaaaattggctaagcttaaacctgtttttggtaagggtgacagcgccacc
atgactgctgcaaactcgaccccattaaccgatggtgcttcagtggtgctcttagcctcg
gaacaatgggcaaaagacaatggtcatgaaattctagcctatctcagcttctctgaaacc
tcggcaatcgactttgttgggaaaaaagaagggctgttaatggcaccaacctatgccgta
cctcgcatgctagaacgcgctaaattaaaattgcaagattttgattattatgaaattcat
gaagcttttgcctcacaagttttggcaacattaaaagcatgggaagatccagtattctgt
aaggaacgcctaggtctagatgcccccttgggcagtatcgatctcaacaaattgaacgtt
aaaggttcatcattggctgcgggtcatccatttgctgcaactggcggacgtctattggcc
acagcagcaaaattactcaatgaaaaaggctctggtcgtgtgttgatttctatttgtgca
gctggtggtcaaggtgtgaccgccatcgttgagaaataa

DBGET integrated database retrieval system