KEGG   Acinetobacter larvae: BFG52_06535Help
Entry
BFG52_06535       CDS       T04708                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ala  Acinetobacter larvae
Pathway
ala00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BFG52_06535
Enzymes [BR:ala01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BFG52_06535
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BFG52_06535
    1.1.1.-  
     BFG52_06535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 Ret2_MD
Motif
Other DBs
NCBI-ProteinID: AOA58040
UniProt: A0A1B2LYM1
Position
complement(1485049..1486107)
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPEVAPGTVGIQVAWCGICGTDLHEFMDGPIFIPPCGHPHPI
SGEEAPITMGHEFSGVVYAVGEGVDDIEVGQHVVVEPYIIGDDVPTGPGDQYHLSKDMNF
IGLGGRGGGLSEKIAVKRRWVHPVAKHVPLDQAALIEPLSVGHHAFVRSGAKSGDVALVG
GAGPIGLLLSAILKAKGLTVIMTELSAKRKEKALESGVADYILDPTQVDVVAEVMKLTDG
KGADVAYECTSVNKVLETLVAACKPTGVIVILSIWSHPATVNIHSVVMKELDIRGTIAYV
NDHQETIKLVEQGKINLEPFITQRIQLDDLVSKGFDTLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctcgattttatgacaagggtgatattcgtattgaagatatccctgaacca
gaagttgcgccaggtaccgtaggtattcaagttgcatggtgtggtatttgtggtacagat
ttacatgaatttatggacggtccaattttcattccaccttgtggtcacccacaccctatc
tctggcgaagaagcgccgattaccatgggacatgagttctctggtgtcgtctatgccgtc
ggtgaaggggttgatgacatcgaagtgggtcaacatgtagtggttgaaccctacatcatt
ggcgatgacgtacccaccggtccgggtgaccaatatcacttgtctaaagatatgaacttt
attggcttaggtggtcgtggtggcggtttatctgaaaaaattgcagtaaaacgccgttgg
gtgcaccctgtagccaaacacgttccgcttgatcaagctgctttgattgaacctctatct
gttggtcaccacgcctttgtgcgcagtggtgccaaaagcggtgatgtagcattggtcggc
ggtgcaggaccgattggtctattgctgtctgcgattttaaaagccaaaggtttgacagta
atcatgacggagctcagtgccaaacgtaaagaaaaagctttagaatctggtgttgcggat
tatattttagacccaacccaagttgacgttgtggctgaagtcatgaaactcactgatggc
aagggtgctgacgttgcttatgaatgcaccagtgtcaataaagtactcgaaaccttggtg
gcggcatgtaaaccaactggggtcattgtgatcttatcgatctggagccacccagccact
gtgaatattcacagtgtggtgatgaaagagctagatatccgcggcaccattgcctatgtc
aatgatcaccaagaaaccatcaaattggttgaacaaggtaaaatcaaccttgaaccgttt
attacacaacgtattcagctcgatgacttggtgtctaaaggttttgacacccttattcac
aacaatgaatctgcggtaaaaattattgttcatccataa

DBGET integrated database retrieval system