KEGG   Acinetobacter larvae: BFG52_09600Help
Entry
BFG52_09600       CDS       T04708                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ala  Acinetobacter larvae
Pathway
ala00020  Citrate cycle (TCA cycle)
ala00480  Glutathione metabolism
ala01100  Metabolic pathways
ala01110  Biosynthesis of secondary metabolites
ala01120  Microbial metabolism in diverse environments
ala01130  Biosynthesis of antibiotics
ala01200  Carbon metabolism
ala01210  2-Oxocarboxylic acid metabolism
ala01230  Biosynthesis of amino acids
Module
ala_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ala_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BFG52_09600
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BFG52_09600
Enzymes [BR:ala01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BFG52_09600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AOA58581
UniProt: A0A1B2M094
Position
complement(2118722..2119975)
Genome map
AA seq 417 aa AA seqDB search
MGYQKIVVPADGTKITVNADLSLNVPNHPIIPFIEGDGIGVDISPAMKAVVDAAVQKAYV
GKRSIEWMEVYCGEKANKIYGSYMPEETFEALREFVISIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCVRPVRWFEGVPSPVQHPELTDMVIFRENSEDIYAGIEWQADSEEAKKVIRFLR
EEMGVTKIRFPEGCGIGVKPVSKEGTQRLVRKAIQFAIDNDKPSVTLVHKGNIMKYTEGA
FKEWGYELAMDRFGGVFIDGGPWIKIKNPKNGKDIIIKDVIADAFLQQILMRPADYSVIA
TLNLNGDYISDALAAEVGGIGIAPGANIGGAIAVYEATHGTAPKYAGQDKVNPGSIILSA
EMMLRDMGWVEAADLIITGISGAIAAKTVTYDFERLMPGATLLRCSEFAKAIIANMD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggttatcaaaagatcgtagtgcctgcggatggtactaaaataacagttaacgcagat
ttgtcattaaacgttcccaatcatcctattattccatttattgaaggggatggtattggt
gtcgatattagtccagcaatgaaggctgtggtcgatgccgcagtacaaaaggcttatgta
ggcaaacgttcgatcgaatggatggaagtatattgcggcgaaaaagccaataaaatttat
ggcagctatatgccagaagaaacttttgaagctttgcgtgaatttgtgatttcaattaag
ggaccattaacaacgcccgttggcggtgggattcgctctttaaatgttgcgctgcgccaa
gaacttgatttatatgtttgtgtgcgtccagtacgttggtttgaaggtgtaccatctccc
gtacagcatccagagttaaccgatatggttattttccgagaaaactcagaagatatttat
gctggaatagaatggcaagcagattctgaagaagctaaaaaagttattcgctttttgcgt
gaagaaatgggcgtgaccaagatccgttttcctgagggatgtggtattggggttaaacct
gtttctaaagaaggcacacaacgtttagttcgtaaagccattcaattcgcgattgataat
gataagccctctgtgacgttggtacacaagggtaatattatgaaatataccgaaggggct
tttaaagaatggggctatgaattagccatggatcgtttcggcggagtattcattgatggt
ggaccatggattaaaatcaaaaatcctaaaaatgggaaagacatcatcattaaagatgtg
attgcagatgctttcttacagcaaattctcatgcgccctgcggattattctgttattgcg
actttaaatttaaatggtgattatatctctgatgctttggcggcagaggttggtggaatt
ggtattgcacctggtgcgaatattggtggtgctattgcggtatatgaagcaacacatggc
acggcgcccaaatatgcgggtcaagataaagtaaacccaggttcaattattttatccgct
gaaatgatgttacgtgatatggggtgggttgaggctgccgatttgattatcacaggaatt
tccggtgcaattgccgccaaaaccgtaacctatgactttgagcggttaatgcctggtgca
acgttattacgctgttctgagtttgctaaagccatcattgcaaatatggattag

DBGET integrated database retrieval system