KEGG   Acinetobacter larvae: BFG52_16175Help
Entry
BFG52_16175       CDS       T04708                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ala  Acinetobacter larvae
Pathway
ala00051  Fructose and mannose metabolism
ala01100  Metabolic pathways
ala01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BFG52_16175
Enzymes [BR:ala01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BFG52_16175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AOA59731
UniProt: A0A1B2M3K8
Position
3657523..3658305
Genome map
AA seq 260 aa AA seqDB search
MQTAQLDKKQLMENAQRSMQQLFQDEDYSDQQKLALTCRILFDHGHDAGLAGQITSRSAK
GNTFITQRFGLGFDEITAANLLEVDQDLKPLNGEGMANPANRFHTWIYKEHPEVNCIIHT
HPTHVAALSMLRVPLIVSHMDTCALYEDCSFVEDWPGVPVGNEEGIFISAALGKNRAVLL
SHHGQLVTGKTIEEACNLAILIERTARLQLLAMAAGQIQQIPHDLAKEAHDWVSTDKRNK
VNFAYYARQALQKHADCIEG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgcacagcttgataaaaaacaactgatggaaaatgctcagcgcagcatgcag
caactgtttcaggatgaagactatagtgatcagcaaaaactcgccttgacctgtcgtatt
ttatttgaccatggtcatgatgctgggctggctgggcaaatcactagccgtagcgcaaaa
ggcaatacgtttattacccagcgctttggtttagggtttgatgaaattactgcagctaat
ttattagaagtagatcaagaccttaagcctttaaatggtgaaggtatggccaatccagcc
aaccgttttcatacttggatttataaagagcatcctgaggtgaattgtattattcatacg
catccgacacatgtggccgcattgtcgatgttaagagtgcctttaattgtttcacatatg
gacacgtgtgccttatatgaagattgttcttttgtggaagattggccaggcgtacctgtg
ggcaatgaagaaggcatttttatttctgcagcattaggcaaaaatcgtgcagttttattg
tcgcatcatgggcagctggtcacgggaaaaaccattgaagaagcatgtaatttggcgatt
ttaattgaacgtactgcgcgtttacagctgttagcgatggcagctggacaaattcaacag
attcctcatgatttggcgaaagaagcacacgattgggtttctacggacaaacgcaataag
gtcaactttgcttattatgcgcgtcaggctttacaaaaacatgcagattgtatcgagggt
taa

DBGET integrated database retrieval system