KEGG   Altererythrobacter sp. B11: AEB_P0328Help
Entry
AEB_P0328         CDS       T05671                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
alb  Altererythrobacter sp. B11
Pathway
alb00360  Phenylalanine metabolism
alb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
alb00790  Folate biosynthesis
alb01100  Metabolic pathways
alb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:alb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AEB_P0328
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AEB_P0328
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AEB_P0328
Enzymes [BR:alb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AEB_P0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: BBC71196
UniProt: A0A2Z5YST5
Position
368806..369744
Genome map
AA seq 312 aa AA seqDB search
MPESALSEIDFAALPEPSDTVFTAPLRRPPHVDEDWLEPAQRDYSAGDDAIWDALFARQM
DVLPGRACSAFLQGLEQLDLGAGGVPDFGRLSKELGRLTGWSVVPVPMLIPDHVFFWHLA
NRRFPAGNFIRTRETFDYIQEPDVFHDVFGHVPMLADPVFADYMQEYGRAGWKAMRHNRL
KALGALYWYTVEFGLIREAGELRIYGAGILSGPQEAVFALEGHSPNRITLDVDRVMRTDY
VIDDLQPTYFVIESLADLYRLTVERDFDQLYRNLDPGFTYANAAVLDSDNVLHPGTQEYH
LRGGRGSSAKPV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaagcgcactcagcgaaatcgacttcgcggccttgccggagccttcggacacg
gtgttcaccgctccgctccgccgcccaccgcatgtggacgaggactggctagagccggcg
cagcgggactattcggcaggggatgatgcgatctgggatgcgctgttcgcgcggcagatg
gacgttcttcccggccgcgcctgcagcgccttcctccagggcctcgagcagctcgatctg
ggcgccggcggcgtgcccgattttggccgcctgtcaaaagagctggggcggctcaccggg
tggagcgtggtgcccgtccccatgctgatccccgaccatgtgttcttctggcatctggcc
aatcgccgcttccccgccggcaatttcatccgcacccgcgaaaccttcgactacatccag
gagccggacgtgttccacgatgtgttcggccatgtgccgatgctcgccgaccccgtattc
gccgattacatgcaggaatatggccgggccggctggaaggcgatgcgccacaaccggctg
aaggcgctgggggcgctctattggtacaccgtggagttcggcctgatccgcgaagcgggc
gaactgcgcatctatggtgcgggtatcctgtccgggccgcaggaagcggtgttcgcgctg
gaggggcattcgcccaaccggatcacgctcgatgtcgaccgggtgatgcggacggattac
gtgatcgacgatctgcagccgacctacttcgtgatcgagagcctggcggacctctaccgc
ctgacggtggagcgcgatttcgatcagctctatcgcaacctcgatcccggcttcacctat
gccaacgccgcggtgctggatagcgacaatgtgctgcatcccggcacgcaggaatatcat
ctgcgcggcggccgcggctcttccgccaagccggtctga

DBGET integrated database retrieval system