KEGG   Altererythrobacter sp. B11: AEB_P1047Help
Entry
AEB_P1047         CDS       T05671                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
alb  Altererythrobacter sp. B11
Pathway
alb00051  Fructose and mannose metabolism
alb00520  Amino sugar and nucleotide sugar metabolism
alb01100  Metabolic pathways
alb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AEB_P1047
   00520 Amino sugar and nucleotide sugar metabolism
    AEB_P1047
Enzymes [BR:alb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AEB_P1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DUF218
Motif
Other DBs
NCBI-ProteinID: BBC71915
UniProt: A0A2Z5YUN7
Position
1087867..1088910
Genome map
AA seq 347 aa AA seqDB search
MTEMALIQPVVLCGGSGTRLWPRSRKARPKPFLPLVDDQTLFEATLARCADPAHFALPIV
VTGAAHLAHVKEQTDRVPGVSIIVEPEAKNTAAAIALAAARLPEDTVMLVCPSDHHIADT
EAFATAARLAADLAAQEWLVSFGISPTTPETGFGYILRGEPLATGFRVARFVEKPDRATA
ETFLASGEYSWNGGIFAFRAGTLMSELARLRPDIAEAVREAVAKGRESGQEFHPDAEAFA
RVEGESIDYAVMEKTARAAVVPVAMGWSDIGNWQALRDAREGDALGNRVRGRVELVDCRN
VLAETDGPRISVIGLEDIAIIVDGDEVLVTTMEGAQKVGKLRGASNQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacagagatggcgctcatccagccggttgttctttgcggtggcagcggcacgcggctg
tggccgcgaagccgaaaggcgcgaccaaagcctttcctgcccctcgtcgacgaccaaacg
ctgttcgaggcgacccttgcccgctgcgcggatcctgcgcatttcgcattgccaatcgtc
gtaaccggcgcggcacatctggcccatgtaaaagagcagacggatcgcgtgcccggggtc
agcatcatcgttgaaccggaagcgaaaaacactgcggcagccattgcgctggcggcagcc
cgtctgccggaagacacggtgatgctggtgtgccccagcgatcatcatatcgccgatacg
gaagcctttgcgactgccgcgcgcctggccgccgatctcgcggcgcaggagtggctcgtc
tcattcggcatctctccgaccacgcctgaaacgggctttggctacatcctacggggggaa
ccgctggcgaccggatttcgtgtcgcccgcttcgtggaaaagcccgatcgcgccaccgcc
gagacatttctggccagcggagagtacagctggaatggcggcatcttcgcgttccgcgcc
ggcacgctgatgtccgaactggcgcgccttcgccccgatattgccgaggcggttcgcgag
gcggtggcgaaggggcgcgaaagcggacaggaattccatcctgacgcagaagcctttgct
cgcgtcgaaggcgaatccatcgactatgccgtgatggagaagaccgcgcgcgcagcagtg
gtgccggtggccatgggctggtcggacatcgggaactggcaggcgctgcgcgatgcgcgc
gaaggcgatgcactgggcaaccgcgtgcgcggacgcgtggaactggtcgattgccgcaat
gtcctcgccgaaaccgacgggccccgcatctcggtaatcggactggaggatatcgccata
atcgtggatggcgacgaggttctggtcaccaccatggaaggcgcgcaaaaggtgggcaag
ctccgcggagcgagtaatcagtga

DBGET integrated database retrieval system