KEGG   Altererythrobacter sp. B11: AEB_P1096Help
Entry
AEB_P1096         CDS       T05671                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
alb  Altererythrobacter sp. B11
Brite
KEGG Orthology (KO) [BR:alb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AEB_P1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ytca YrvL
Motif
Other DBs
NCBI-ProteinID: BBC71964
UniProt: A0A2Z5YUY0
Position
complement(1141519..1143132)
Genome map
AA seq 537 aa AA seqDB search
MQDISVSPDEPSAAPVLPFGLSWTSLGFGVLFVGMTGYFLFWGLDYTNHAHVMLFVLATL
FGVFMAFNIGGNDVANSFGTSVGAGTLSIKQALMIAAVFEVSGAVIAGGEVTDTIRSGIV
DLSATAVEPMQFVYIMMAALLSAALWLLFASRNGWPVSTTHSIVGGIVGASIALGMLLSG
GGAALALVQWDEIGTIVLSWVLSPLLGGVVSYLLYYQIKTHILGYNERAKQQLQLLRQER
RKLNERHRSAFEKLSDIQKISYTNTMVRDGVALREEDFSPEELESDYFRELVEIKRRRES
IAAHKALQNWVPLVAAAGSAIISSMLLFKGLKNMHLEISTLHNYLIMAMIAAAAWMATFV
FVRSLRNGSLDRSTFLLFSWMQVFTAAGFAFSHGANDIANAIGPFAAIMDVLRSGTMEST
AAIPSVAMITFGVALIAGLWFIGKEVIRTVGQELTQMHPASGFSAELSAAAVVMLASTFG
IPVSSTHILIGAVLGIGIVNRQTNWALMKPIALAWVVTVPAAGLLGAGGFLVLNALF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacatatccgtgtctccggacgagccctccgccgcaccggtgctgcccttcggg
ctcagctggaccagccttggcttcggcgtgctgttcgtggggatgaccgggtatttcctg
ttctggggcctcgattacaccaatcacgcgcatgtgatgctgttcgtgctggccacgctg
ttcggcgtgttcatggccttcaacatcggcggcaacgatgtggccaattccttcggcacc
agcgtgggcgcgggcacgctgtcgatcaagcaggcgctgatgatcgcggcggtgttcgaa
gtgagcggtgcggtgatcgcgggcggcgaggtgacggacacgatccgcagcggcatcgtc
gatctgtccgccaccgcggtcgagccgatgcagttcgtctatatcatgatggcggcgctg
ctttcggcggcgctgtggctgctgttcgccagccgcaacggctggcccgtctccaccacc
cattccatcgtcggcgggatcgtcggcgcctccatcgcgctgggcatgctgctgagcggc
ggcggtgcggcgctggcgctggtgcagtgggacgagatcggcaccatcgtgctgtcctgg
gtgctttccccgctgctgggcggggtcgtgtcctatctgctctactaccagatcaagacc
cacatcctcggctacaacgaacgcgccaagcagcagctgcaattgctgcggcaggaacgg
cgcaagctgaacgaacgccaccgcagcgccttcgagaagctgagcgacatccagaagatc
tcctacaccaacaccatggtgcgcgacggcgtggccctgcgcgaggaggacttctcgccc
gaggagctggagtccgactatttccgcgaactggtggagatcaagcgccggcgcgaaagc
atcgccgcgcacaaggccttgcagaactgggtgccgctggtggcggcggcgggctccgcg
atcatctcctccatgctgctcttcaagggcctgaagaacatgcatctggagatctccacc
ctccacaattacctgatcatggcgatgatcgccgccgccgcgtggatggcgactttcgtg
ttcgtgcgctcgctgcgcaacggatcgctcgatcgttcgaccttcctgctgttcagttgg
atgcaggtgttcaccgccgccggcttcgccttcagccatggcgcgaacgacatcgccaac
gccatcggccccttcgccgcgatcatggacgtgctgcgcagcggcacgatggaaagcacc
gccgccatccccagcgtcgccatgatcaccttcggcgtggcgctgatcgccggcctgtgg
ttcatcggcaaggaggtgatccgcacggtcggccaggagctcacgcagatgcacccggcc
tccggcttttccgcggagctgtccgccgccgcggtggtcatgctcgcctccaccttcggc
atcccggtgtccagcacgcacatcctgatcggcgccgtgctcggtatcgggatcgtcaac
cggcagaccaactgggcgctgatgaagccgatcgcgctggcctgggtcgtcaccgtgccg
gccgccggcctgctgggcgcgggcggcttcctggtgctgaacgcgctgttctga

DBGET integrated database retrieval system