KEGG   Altererythrobacter sp. B11: AEB_P1216Help
Entry
AEB_P1216         CDS       T05671                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
alb  Altererythrobacter sp. B11
Pathway
alb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:alb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AEB_P1216
Enzymes [BR:alb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AEB_P1216
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AEB_P1216
    1.1.1.-  
     AEB_P1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_2 PALP
Motif
Other DBs
NCBI-ProteinID: BBC72084
UniProt: A0A2Z5YVA0
Position
complement(1277186..1278187)
Genome map
AA seq 333 aa AA seqDB search
MKAATFQALHQPLALEDLPDPTPSRGDVVVQVGRCGICGSDLHMTEDAAYGCRHGDILGH
EFAGEVVAAGADVEGLKTGDLVSVIPLKSCGTCEHCRKGEVQWCAGFGLQGGGYAEYALT
RPNQCVKLPQGLSLADGAIIEPLAVALHGVNLSGLQSGDRVLVLGAGPIGLAVAFWARRF
GAGRVAVQDIADHQQQRALDMGANVFVVDPADPVGSAEAALGGKADIVFECVGVPGLVAQ
AVEQLRPRGTILLLGLCTRPDTFNSFAMLSKEVRLVTSAFFTVAEYRAALDALAAGAIEP
RLLVSDTIALDDVPAVFESLKQRSGQCKVLIAP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcggcgacgtttcaggccctgcaccagccgctcgcgctggaggatctgcccgac
cccaccccgtcgcgcggcgatgtggtggtgcaggtgggccgctgcggcatctgcggcagc
gacctccacatgaccgaggacgccgcctatggctgccgccacggtgacatactgggccat
gaattcgccggcgaggtggtcgcggccggagccgatgtcgaggggctgaagacgggcgat
ctcgtctccgtgatcccgctcaagagctgcggcacctgcgagcattgccggaagggcgag
gtgcaatggtgcgccggcttcggcctgcagggcggcggctatgccgaatatgccctcacc
cgccccaaccaatgcgtgaaattgccgcaaggcctctcgctggcggatggcgcgatcatc
gaaccgctggccgtggcgctgcatggcgtgaacctgtccggcctgcagagcggcgaccgg
gtgctggtgctcggcgccggcccgatcggcctcgcggtggcgttctgggcgcggcgcttc
ggcgcggggcgggtggcagtgcaggacatcgccgaccaccagcagcagcgcgcgctggac
atgggcgcgaatgtgttcgtggtcgatcctgccgatccggtgggcagcgcggaggcggcg
ctgggtggcaaggccgatatcgtgttcgaatgcgtgggcgtgcccggcctcgttgcgcag
gcggtggaacagctgcgcccgcgcggtacgatcctgctgctcggcctctgcaccaggccc
gataccttcaacagcttcgccatgctgtccaaggaggtgcgcctcgtcaccagcgccttc
ttcaccgtggccgaatatcgcgcggcgctcgatgcgctggccgccggcgccatcgagccg
cgcctgctggtgagcgacacgatcgcgctggatgacgtgccggcggtgttcgaaagcctc
aagcagcgcagcgggcaatgcaaggtgctgatcgcgccctag

DBGET integrated database retrieval system