KEGG   Altererythrobacter sp. B11: AEB_P1341Help
Entry
AEB_P1341         CDS       T05671                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
alb  Altererythrobacter sp. B11
Pathway
alb00620  Pyruvate metabolism
alb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AEB_P1341
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:alb02000]
    AEB_P1341
Enzymes [BR:alb01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     AEB_P1341
Transporters [BR:alb02000]
 Other transporters
  Primary active transporters [TC:3]
   AEB_P1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like STI1
Motif
Other DBs
NCBI-ProteinID: BBC72209
UniProt: A0A2Z5YVP4
Position
complement(1409849..1411210)
Genome map
AA seq 453 aa AA seqDB search
MERCGFKAIDFTTSTHMGVAVRYKQEDPWERIRLMAEACRTTPLQFLSTGFRFIAWETAT
PEFMELAFRTLARNGIRRFALADPMNDARSNVEVARMVKRAGGEQVIGALVYTISPIHDD
AHYAEAARIMAESPDVDALYIKDPGGLLSSKRAQTLIPAIMAQIGDKKLELHAHCTIGLA
EQAYLEGVELGASAVQCASGGAADGTSNPPIERMIANLRELGHTVEVDDEAVAEVAQYFR
ELAEAEGLPTGRPMAFDAAYLHHQLPGGMVGTMRRHLADHRVPHLEGAVIEELGRVREEL
GWPIVMTPFAQMLQTQAVMNVTGEERYAVIPDEIIRYAIGKFGRPNMPIEPNVMDKIMAN
PRTRELEAEQGMADLDTLRKRIGTGLSDEEFLLRATMPANLVDAMQAAGPAERHYQPRNA
PVVELLRQVLARTDLTRVSVEKAGFKLELESNA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctgcggcttcaaggccattgacttcaccaccagcacccatatgggcgtggcg
gtgcgttacaagcaggaggatccgtgggagcgcatccgcctgatggccgaggcctgccgc
accacgccgctgcagttcctgtccaccggcttccgcttcatcgcctgggaaacggcgacg
ccggaattcatggagctggccttccgtacgctggcgcgcaacggtatccgccgcttcgcc
ctggccgatccgatgaacgatgcacgcagcaatgtggaagtggcgcgcatggtgaagcgg
gccgggggcgagcaggtgatcggtgcgctggtctatacgatcagcccgatccatgacgac
gcgcattatgccgaggcggcgcggatcatggccgaaagcccggatgtggacgcgctgtat
atcaaggatcccggcggcctgctgtcgtccaagcgggcgcagacgctgatccccgcgatc
atggcgcagatcggcgacaagaagctggaactgcacgcccattgcaccatcgggctggca
gagcaggcctatctggaaggcgtggagctgggcgccagcgcagtgcaatgcgccagcggc
ggcgcggccgacggcaccagcaacccgccgatcgagcggatgatcgccaatctgcgcgaa
ctgggccacacggtggaggtggatgacgaggcggtggccgaggtggcgcaatatttccgc
gagctggccgaagccgaaggcctgcccaccggccgcccgatggccttcgacgcggcctat
ctccaccaccagctgcctggcggcatggtcggcaccatgcgccgccatttggccgatcac
cgtgtgccgcatctggaaggcgccgtgatcgaggaactgggccgcgtgcgcgaggaactg
ggctggcccatcgtgatgacgcccttcgcccagatgctgcagacgcaggcagtgatgaat
gtgacgggggaggaacgctacgccgtgatccccgacgagatcatccgttatgcgatcggc
aagttcggccggcccaacatgcccatcgagcccaatgtgatggacaagatcatggccaat
ccgcgcaccagggagctggaggcggagcagggcatggccgatctcgatacgctgcgcaaa
cgcatcggcaccgggctttcggacgaggaattcctgctgcgcgccaccatgcccgccaat
ctggtggacgccatgcaggccgccggcccggcggaacggcattaccagccgcgcaacgcg
ccggtggtcgaactgctgcggcaagtgctcgcccgcaccgatcttacgcgcgtcagcgtg
gagaaggcgggcttcaagctggaactggaaagcaacgcctga

DBGET integrated database retrieval system