KEGG   Altererythrobacter sp. B11: AEB_P1520Help
Entry
AEB_P1520         CDS       T05671                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
alb  Altererythrobacter sp. B11
Brite
KEGG Orthology (KO) [BR:alb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AEB_P1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 YwhD
Motif
Other DBs
NCBI-ProteinID: BBC72388
UniProt: A0A2Z5YW08
Position
1584989..1585402
Genome map
AA seq 137 aa AA seqDB search
MQDVLASLFQHTALTAGVTVRVAVNFMPDQSRVDAGRWFWVYHIRIENHREDTVQLRSRH
WRITDSRGMVNIVDGEGVVGESPVLAPGQTHDYVSGCELMTNHGTMEGHYTFARADGTLF
EVAIPFFPLAAPAPTVG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgtcctcgccagcctgttccagcacactgccctcaccgccggcgtgacggta
cgcgtggccgtgaacttcatgcccgatcagtcgcgcgtggatgccggccggtggttctgg
gtctatcacatccgcatcgagaaccatcgcgaagacacggtgcaattgcgcagccgccat
tggcggatcacggattcgcgcggcatggtgaacatcgtcgacggcgaaggcgtggtgggc
gaaagcccggtgctggcgccggggcagacgcatgattacgtttcgggctgcgagctgatg
accaatcacggcacgatggaaggccattacaccttcgcccgcgccgatggcacgctgttc
gaagtggcgattcccttcttccccctcgcagcccccgctcccaccgtcgggtga

DBGET integrated database retrieval system