KEGG   Altererythrobacter sp. B11: AEB_P2426Help
Entry
AEB_P2426         CDS       T05671                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
alb  Altererythrobacter sp. B11
Pathway
alb00561  Glycerolipid metabolism
alb00640  Propanoate metabolism
alb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AEB_P2426
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AEB_P2426
Enzymes [BR:alb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AEB_P2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase PGDH_C
Motif
Other DBs
NCBI-ProteinID: BBC73294
UniProt: A0A2Z5YYN2
Position
complement(2533523..2534698)
Genome map
AA seq 391 aa AA seqDB search
MSWERGMRKAAIEIFGGAQSLDSTKVFFCAHRYVQGPGVLEDIDTYLPMVGGRVPGLLLP
GDLPPAIGETVEAAFATADIAAVRSAFGGQCSFEEIDSQVATFRAAAIDVLVAIGGGKVI
DAAKCIARRINVPLIVCPTLASTDAPCSAAAVVYTAEGAFRDVEFLPSNPDLVVVDTAII
AKAPVRFLLAGMADALATGYEARTCVANAAARSMVGGRITIAAATIAEICSRTIFEHADN
AVAAVKSGILNESFERVVEANTLLSGTGFESGGLAAAHAVASALTLVPSIEHRFLHGEMV
AVGTMIHLQLEGDGAELERVDTLLARLGLPRALSDLGITVQDGDGTFVMLVEAACNFPFM
KNEPFEVTPDILKKAIFEVEERRMSSAQYAA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggagaggggcatgcggaaggcagcgatagagatatttggcggggcgcagtcc
ctggatagcaccaaggtgtttttctgcgcacaccgctatgtgcagggaccaggcgtactc
gaagatatcgacacttatttgccgatggtcggcggtcgggtgcccgggctcttgctgcca
ggcgatcttccccccgcgatcggcgagacggtcgaagccgcatttgccaccgctgacatc
gcggcggtccgttctgcgttcggcggccagtgttcgttcgaagaaatcgattcgcaggtg
gcaacctttcgggccgcagctatcgatgttctcgttgccatcggtggtgggaaggtgatc
gatgccgccaaatgcattgcccgccgaatcaatgtgcccctgattgtctgccccacactc
gcgtctaccgatgcgccttgctctgcagcggccgtggtctacacggccgaaggcgctttc
agagacgtcgaattccttcccagcaacccggatttggtcgtagtagacacagcgataatc
gcgaaggcgccggtgcggttcctccttgccggtatggcggacgccctcgcgaccggctac
gaggcgcggacctgcgtcgctaatgcggctgcgcgttccatggtcggtggacggatcaca
atcgccgccgcaaccattgcggaaatatgctcgagaacgatttttgagcatgcagacaac
gcagtggctgcagtaaaatccggcattctcaatgaaagtttcgaacgtgttgtggaagcc
aacacgttgctgagcggtaccgggttcgaaagtggtgggctggcggccgcccatgcggtc
gcctcggctctaacccttgtaccatcaatcgagcaccgctttcttcacggcgaaatggtg
gccgtcgggacgatgattcacttgcaactcgagggggacggggcagagttggagcgtgtg
gatacgcttctcgcccgcttgggcctaccccgtgccctctcggatctcggcatcaccgta
caggacggggatgggacgttcgtcatgctcgtggaagccgcgtgtaatttcccttttatg
aagaatgagccgttcgaagtcacccccgatatactgaagaaggcgatattcgaagtcgaa
gaacggcgcatgtcttcggcgcaatacgccgcctaa

DBGET integrated database retrieval system