KEGG   Acinetobacter lactucae: OTEC02_13405Help
Entry
OTEC02_13405      CDS       T05220                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
alc  Acinetobacter lactucae
Pathway
alc00040  Pentose and glucuronate interconversions
alc00053  Ascorbate and aldarate metabolism
alc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OTEC02_13405
   00053 Ascorbate and aldarate metabolism
    OTEC02_13405
Enzymes [BR:alc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     OTEC02_13405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARD29693
UniProt: R8Z3K9
Position
complement(2817288..2818874)
Genome map
AA seq 528 aa AA seqDB search
MSKNNGRQFINGQRVAANAPALESVAAKDYQPTGYVFSQATLEEVDQAAQAAHNAFLVYS
QTSQEQRASFLEEIACQIEALGANLQEVASLETGLPLARLQGETGRVTGQLRLFAELLRR
GDFYGARIDVALPERKPLPRVDLRQYKVGVGPVAVFGASNFPLAFSTAGGDTVAALAAGC
PVVFKAHSGHMATAELVAEAIEKAIEVCDMPKGTFNMIFGGRIGANLVEHPLIQAAGFTG
SLEGGMALYNLAQSRPQPIPFFAEMSSVNPVVVLSQALSSRGEQIAQDTVASFNMGCGQF
CTKPGLILGVQGPEFDSFVAALSESTQKAVPQVMLNEGTLKSYRQGIDALNSEAGFEVVA
TGQEAELVSQAKAHLFKADQSVLLSGNPKLQHEVFGPMSIVIGVEDEATLLKGIEALGGQ
LTATIIGDENELSEAGELLHLLTGKAGRVLFNGFPTGVEVSDAMVHGGPFPATSDARGTS
VGTGAIERFLRPVCFQNTPQVLLPDALKDSNPLQITRLVNGQLSQAQI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaataacggtcggcagtttattaatggtcaacgcgttgctgcaaatgcgcca
gccctagaaagtgtagctgcaaaagactatcaaccaacaggttatgtatttagtcaggca
acacttgaagaagtggatcaagctgctcaagctgcgcataacgcatttttagtttatagc
caaacttctcaagagcaacgtgcctcttttcttgaagagattgcttgccaaattgaagca
ttaggtgcaaacctgcaagaagtcgcttcacttgaaacaggcttgccacttgctcgtctt
caaggagagacaggccgtgttactggtcagcttcgattgtttgctgaacttttacgtcgt
ggcgatttttacggtgctcgtattgatgtggcattgccagaacgtaagcctttgccgcgt
gttgatttgcgtcaatataaagttggggtaggaccggttgctgtgtttggcgcgagtaat
ttcccacttgcattttcaactgcaggcggtgataccgtagctgctttagcagcaggctgt
ccggttgtttttaaagcacactctggccatatggcaactgccgagcttgttgcagaagcc
attgaaaaagcaatcgaagtttgcgatatgcctaaaggcacattcaatatgatttttggc
ggccgtattggcgcaaacttggtggaacatccactcattcaagcagctggatttacaggt
tctcttgaaggtggaatggcgctttataaccttgcgcagagccgtcctcagccaattcca
ttctttgctgaaatgtcgagtgtgaaccctgtagtggttttatcccaagcactgagttct
cgtggtgaacaaatcgctcaggatacggttgcctcatttaatatgggatgtggtcagttc
tgtacaaaacccgggttaattttaggcgtacaaggtcctgaatttgacagtttcgtagca
gctttatctgaaagcacgcaaaaagctgtgcctcaggttatgctgaatgaaggaacttta
aaaagctaccgtcaaggtattgatgctctaaacagcgaagctggttttgaagtagttgcg
acaggtcaagaggccgagctagtttctcaagcaaaagcacatctatttaaagcggaccaa
tctgttttactatcaggcaacccaaaactacaacatgaagttttcggaccaatgtcgatt
gtgattggcgtagaggatgaagcgactttattaaaagggattgaagctttaggtggacag
ctcacggcaaccattattggtgatgaaaatgagttgtccgaagcaggcgagcttctccat
ttgctaaccggtaaagctggtcgtgtattgtttaatggcttcccaacaggagttgaagtg
tctgatgccatggtacatggtggtcctttccctgcaacgagtgatgcacgaggaacttcg
gtaggtacgggagcaattgagcgtttcttgcgtccggtatgtttccaaaatacaccacaa
gttttattacccgatgcattaaaagatagtaatccactacagattactcgtctggttaat
ggacagttaagtcaggctcaaatttaa

DBGET integrated database retrieval system