KEGG   Acinetobacter lactucae: OTEC02_17920Help
Entry
OTEC02_17920      CDS       T05220                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
alc  Acinetobacter lactucae
Pathway
alc00480  Glutathione metabolism
alc00590  Arachidonic acid metabolism
alc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    OTEC02_17920
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OTEC02_17920
Enzymes [BR:alc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     OTEC02_17920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ARD30468
UniProt: A0A1V0KFL4
Position
3777508..3778053
Genome map
AA seq 181 aa AA seqDB search
MTQSVYHIPVKAISGETVDLEQYKGKVLLIVNTASKCGLTPQYEGLEKLYQAKKDQGLEI
LGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKVSVVGEDKHPLYQALTAAQPERTG
EGPFRERLEGLGIQTNPAPEVLWNFEKFLINKNGEVVARFAPNLTADDEQIVKAVEAELA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatctgtatatcacatcccagtaaaagctatttcaggcgaaacggttgatctt
gaacaatataaaggtaaagttctacttatcgtaaatactgcttctaaatgtggtttaact
ccacaatacgaaggcttagaaaaactttatcaagcaaaaaaagaccaaggtcttgaaatc
ttaggtttcccagcaaacaactttaaagagcaagaaccgggttctgatgaagaaattcag
caattctgttcattaaattatgatgttcatttccctttattttctaaagtttctgtagtc
ggtgaagataagcacccactttaccaagctttaacagcagctcaaccagaacgtactggt
gaaggtcctttccgtgagcgtttagaaggcttaggtattcaaaccaaccctgctccagaa
gttttatggaacttcgaaaagttcttaattaataagaatggtgaagtcgtggctcgcttt
gctccgaacctaacagcagacgatgaacaaatcgttaaagcagttgaagcagagttagca
aaataa

DBGET integrated database retrieval system