KEGG   Alteromonas sp. Mac1: AV939_03960Help
Entry
AV939_03960       CDS       T05687                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ale  Alteromonas sp. Mac1
Brite
KEGG Orthology (KO) [BR:ale00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AV939_03960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AMJ85813
Position
complement(951957..952331)
Genome map
AA seq 124 aa AA seqDB search
MNESEIKVRVKTRHLPEHLPSDSPQFAFAYHVTIVNDSQETVQLINRYWQITDANGKTSE
VSGSGVVGKQPILKPGEDFDYTSGAVLDTPVGNMQGYYEMERENGERFRVPIEVFRLAVP
NILH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagtctgaaattaaggtgcgggtgaaaacccgtcacctgcccgaacatctacct
tctgattcgccacaattcgcgttcgcttatcacgtgaccattgtgaatgacagccaggaa
acggtacaactgattaatcgttactggcaaattaccgatgctaacggtaaaacctcagag
gtgagtggctcaggagttgtcggtaaacagcccatattaaaaccgggcgaagattttgac
tataccagtggtgcagtacttgataccccggtaggaaatatgcaaggctattacgaaatg
gagcgtgaaaacggtgaacgttttcgtgttcccattgaagtattccgtttagcggttccc
aacattcttcactaa

DBGET integrated database retrieval system