KEGG   Alteromonas sp. Mac1: AV939_05285Help
Entry
AV939_05285       CDS       T05687                                 

Definition
(GenBank) alanine--glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
ale  Alteromonas sp. Mac1
Pathway
ale00250  Alanine, aspartate and glutamate metabolism
ale00260  Glycine, serine and threonine metabolism
ale00630  Glyoxylate and dicarboxylate metabolism
ale00680  Methane metabolism
ale01100  Metabolic pathways
ale01110  Biosynthesis of secondary metabolites
ale01120  Microbial metabolism in diverse environments
ale01130  Biosynthesis of antibiotics
ale01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AV939_05285
  09102 Energy metabolism
   00680 Methane metabolism
    AV939_05285
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AV939_05285
   00260 Glycine, serine and threonine metabolism
    AV939_05285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ale01007]
    AV939_05285
Enzymes [BR:ale01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     AV939_05285
    2.6.1.45  serine---glyoxylate transaminase
     AV939_05285
    2.6.1.51  serine---pyruvate transaminase
     AV939_05285
Amino acid related enzymes [BR:ale01007]
 Aminotransferase (transaminase)
  Class V
   AV939_05285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMJ88750
Position
1282944..1284023
Genome map
AA seq 359 aa AA seqDB search
MGPGPSDVNPRILNAIARPTVGHLDPLFIELMDATKQLLQYAFKTENALTMPISAPGSAG
MEACFVNLVEPGDKVLVCINGVFGNRMVENVERCGGQAIVLKNDWGKQTDLNAVEDALKK
DADIKVLAFVHAETSTGVENDAKHLCELAKQYDCLSIVDAVTSLGGIELDVDGWGIDAIY
SGSQKCLSCVPGISPVSFSDRAVHVIQNRKTKVQSWFLDMNLIVGYWGKGAKRAYHHTAP
VNSMYAFYEALLILKEEGLENAWQRHQAGHNELVAGLEGLGLSLAVDAEYRLPQLNVVNI
PDGVNDAEVRSRLLNDFNLEIGAGLGEFAGKVWRIGLMGYACKPRNIDHCLTSLQKVLK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggggcctggtccttcagacgtgaaccctcgtattctcaatgcgattgccagaccgact
gttggtcatttagatccgctatttatcgagcttatggatgcgaccaaacagcttcttcaa
tacgcatttaaaactgaaaatgcattaacaatgcctatttctgcgccaggttctgcgggg
atggaagcttgttttgttaaccttgttgagcccggcgataaagtgttggtatgcattaac
ggcgtgttcggcaaccgtatggtggaaaatgttgaacgctgcggtggtcaagccatcgta
cttaaaaacgattggggcaagcaaaccgatttaaacgcggtagaagatgcacttaaaaaa
gatgcagatattaaagtgcttgcattcgtacatgcagagacgtcaaccggcgtggaaaat
gatgcaaaacatttatgtgaacttgcaaaacagtacgactgtttatcgatagtagacgcc
gttacctctttaggcggtattgagctagacgtagatgggtggggcattgatgccatttat
tctggctcccaaaaatgtttaagctgcgtaccgggtatttcaccggtatcctttagtgac
cgcgcagtgcatgttattcaaaaccgcaaaactaaagtacaaagctggtttttagacatg
aacttaattgttggctattgggggaaaggggctaagcgtgcttatcaccatactgcacca
gtaaacagtatgtatgcattttatgaagccttacttattttaaaagaagaaggcttagaa
aacgcatggcaacgtcatcaagccggtcataacgagctggtggctggactagaaggctta
ggtctctcgcttgccgtagatgccgaatatcgtctccctcaacttaatgtagtcaatatt
ccagatggtgttaatgacgctgaagttcgttcaaggttacttaacgatttcaatttagaa
attggtgcgggtttaggtgaatttgcaggtaaagtgtggcgcattggattaatggggtat
gcctgtaagcctcgtaatatcgaccattgcctcacatccttacaaaaagtattgaaataa

DBGET integrated database retrieval system