KEGG   Alteromonas sp. Mac1: AV939_08845Help
Entry
AV939_08845       CDS       T05687                                 

Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
ale  Alteromonas sp. Mac1
Pathway
ale00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ale00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AV939_08845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ale01007]
    AV939_08845
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ale03016]
    AV939_08845
   03029 Mitochondrial biogenesis [BR:ale03029]
    AV939_08845
Enzymes [BR:ale01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     AV939_08845
Amino acid related enzymes [BR:ale01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   AV939_08845
Transfer RNA biogenesis [BR:ale03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AV939_08845
 Prokaryotic Type
   Other AARSs
    AV939_08845
Mitochondrial biogenesis [BR:ale03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AV939_08845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: AMJ86674
Position
complement(2074109..2075869)
Genome map
AA seq 586 aa AA seqDB search
MRTDYCGNIDSSYIGQEITLCGWVNKRRDLGGVIFIDLRDREGIVQVVFDPDLPEVLSVA
NKLRGEFCVKLTGKVRARPEGQINKDMRTGEIEILGTGLEIINRSDALPLDWNQENSEEQ
RLRYRYLDLRRPVMSQRLQFRAKVTGAVRRFLEGEGFLDIETPILTKATPEGARDYLVPS
RTHKGEFFALPQSPQLFKQLLMMSGMDRYYQIVKCFRDEDLRADRQPEFTQIDIETTFLD
ADGVMAITESMIRDLFNTMLNVDLGDFPRMTYAEAMKRFGSDKPDLRNPLELTDIADLLE
TVEFKVFSGPANDPKGRVAAIRVPGGASMSRKQIDEYTKFVGIYGAKGLAWMKVNEMAPG
QEGLQSPILKFLSEDITDGILQRTGAQAGDILLFGADTNTVVTEAMGALRLKLGEDFELL
EGEWKPLWVVDFPMFEEFDGQLHAIHHPFTAPRGLTAEELKANPVGALSDAYDMVLNGCE
LGGGSVRIHNEEMQSAVFDILGIDEEEAKNKFGFLLEALRFGAPPHAGLAFGLDRLVMLM
TGATSIRDVMAFPKTTTAACPLTSAPSPANPKQLEELAIATVKKPS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacagattactgtgggaacatcgattcatcatacattgggcaagaaatcaccctg
tgtggttgggtaaacaaacgccgtgacttaggtggcgtaatcttcatcgacttacgagac
cgcgaaggtatcgttcaagtggtattcgaccctgatttaccagaggtattaagcgtagcg
aataaacttcgcggtgaattctgcgtgaagcttaccggtaaagtgcgtgctcgccctgaa
ggccaaatcaacaaagatatgcgtaccggcgaaattgagattttaggcacaggtctagaa
atcatcaatcgctctgatgcgctaccacttgattggaaccaagagaactctgaagagcag
cgtttacgctaccgttaccttgatttacgtcgccctgttatgagccagcgcttacagttt
cgcgctaaagtaaccggtgcagtacgtcgtttcttagaaggcgaaggctttctagacatt
gaaactcctattttgaccaaagcgacacctgaaggtgctcgtgattacttagtacctagc
cgtacccataaaggtgaattctttgcactgccgcaatcgcctcaattgtttaagcaattg
ctgatgatgtctggcatggacagatactatcaaatcgttaaatgcttccgtgacgaagat
ttacgtgccgatcgccaaccagaatttacccaaatcgatatcgaaactacgtttttagat
gccgatggtgttatggccattactgaaagcatgatccgcgacttattcaacaccatgttg
aatgtagatttgggcgatttcccgcgtatgacttacgccgaagcaatgaaacgttttggt
agcgacaagcccgatttacgcaacccgctagagcttaccgatattgctgacttactggaa
accgttgagtttaaagtattcagtggccctgctaacgatcctaaaggtcgtgttgcggct
attcgtgtaccaggcggtgcgagcatgtctcgtaagcaaattgacgagtacactaagttc
gtaggcatttacggcgcgaaaggcttagcgtggatgaaagtaaacgaaatggcaccaggc
caagaaggtttacaatcacctattcttaagttcctaagtgaagatattaccgacggtatt
ttgcagcgcactggcgctcaagctggcgacatcttgttatttggtgccgacactaacacg
gtagttaccgaagccatgggcgcacttcgccttaaactaggtgaagactttgagttatta
gaaggcgagtggaagccgttgtgggttgtcgacttcccaatgttcgaagagttcgatgga
cagctgcatgctatacaccatccgtttactgcgcctcgtggcttaactgcagaagagctt
aaagccaaccctgtcggcgcattgtctgatgcctacgacatggtattaaacggttgcgag
cttggtggtggttcagtacgtattcacaatgaagaaatgcaatctgccgtatttgacatt
ttgggtatagatgaagaagaagcgaagaacaagtttggcttcttacttgaagccttacgc
tttggtgcaccgcctcacgcaggtcttgcgtttggtttagaccgcttagtgatgctaatg
actggtgcgacgtcaattcgcgatgtcatggcattccctaaaaccaccacagcggcatgc
ccattaacgtctgcgccaagccctgcgaatccaaagcagttggaagagttggcgattgca
acggtaaaaaagccgtcgtaa

DBGET integrated database retrieval system