KEGG   Alteromonas sp. Mac1: AV939_09765Help
Entry
AV939_09765       CDS       T05687                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ale  Alteromonas sp. Mac1
Pathway
ale00620  Pyruvate metabolism
ale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AV939_09765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ale02000]
    AV939_09765
Enzymes [BR:ale01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     AV939_09765
Transporters [BR:ale02000]
 Other transporters
  Primary active transporters [TC:3]
   AV939_09765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N NQRA GCV_H
Motif
Other DBs
NCBI-ProteinID: AMJ86832
Position
complement(2295128..2296930)
Genome map
AA seq 600 aa AA seqDB search
MSKPLALTELVLRDAHQSLLATRMRIEDMLPIAEKLDKAGFWSVESWGGATFDSCIRYLG
EDPWDRIRQLKTAMPNTKQQMLLRGQNLLGYRHYADDVVTRFVERAHENGVDVFRIFDAM
NDMRNLKTAIKATVDSGAHAQGTISYTVSPVHNLQLWLDMAKQLEDMGVHSICVKDMAGL
LKPYDCEALITGLKETVSVPIAMQCHATTGLSTATYQKAIDAGIDMLDTAISSMSMTYGH
TATETMVSIVEGTERDTGMSLPDLEEIASYFRGVRKKYSKFEGSLKGVDARILLAQVPGG
MLTNMESQLKEQGAEDKFEEVLKEIPRVREDLGFIPLVTPTSQIVGTQSVLNVLTGERYK
SITKETAGVLKGEYGATAAPVNKALQERVLDGGQPITCRPADNIAPELDSLETELTKLAS
EKSITLSDTKIDDVLTYALFPQIGLKFLENRGNPDAFEPAPGTEADVASSVPAAAPVSAT
GAPAAYDVKVEGKVYHVEVAASGELSSITPGQPSTAAPAAQPASSSSSESAQSINAPLAG
NVFKILVRAGDVVNEGDVVIILEAMKMETEIRSAVSGTVSEVLVGEGDAVASAQPLIALG
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagccactggccttaaccgagctagtcttgcgtgatgcccatcaatcgctactt
gctacgcgtatgcgtatagaagatatgctgcctattgccgaaaaacttgataaagcaggt
ttttggtctgttgaatcttggggcggggcgacatttgattcctgtattcgctatttaggg
gaagatccttgggatcgcattcgccagcttaaaacggcaatgccaaacacgaagcaacag
atgttgttgcgtggtcaaaatttattaggctatcgccattacgctgacgatgtagtgaca
cgctttgttgagcgtgcacatgaaaatggggttgatgtatttcgtatcttcgacgccatg
aacgacatgcgtaatctgaaaacagcgattaaagccaccgtcgacagtggtgctcatgcg
caaggtacaatctcttacaccgtgagcccagtgcataaccttcagctttggctagatatg
gccaagcaactagaagatatgggggttcactctatttgcgtaaaagatatggcggggctg
ttaaagccttacgactgtgaagcgctaattacgggtttaaaagaaaccgtcagtgtgcct
attgctatgcagtgtcatgccactacagggttaagcacggcgacttaccaaaaagccatt
gatgctggcatcgatatgcttgataccgccatttcttcaatgagtatgacatacggtcac
accgcaactgaaaccatggtgtctattgttgagggcacagaacgagatacgggtatgtca
ttacccgatcttgaagagatcgccagctacttccgtggcgtgcgcaaaaaatacagtaaa
tttgaaggtagcttgaaaggggttgatgcccgtatcttactagctcaagtacctggcggc
atgttaaccaacatggaaagccagttaaaagagcaaggcgctgaagataagtttgaagaa
gtgctaaaagaaattcctcgcgtacgtgaagatttaggctttattcctctggttacccca
acgtcgcaaattgtaggtacgcagtctgtattgaacgtactcaccggtgagcgttacaag
agtatcaccaaagaaacggcgggtgtccttaagggcgagtacggtgcaactgccgcgcca
gtaaataaagcactacaagaacgcgtgttagatggtgggcaacccattacctgtcgtccg
gcagataatattgcacctgaactagacagccttgaaacagagcttactaagttagcatca
gagaaaagtattacgctatcagatactaagattgacgatgtgcttacttatgcattgttc
ccacaaattgggctgaagttcctagagaatcgtggcaaccctgacgcatttgaacctgcg
cctggcactgaagctgatgtagcatcaagtgtgccagcggctgcgcccgtttcagctacc
ggcgcaccagcggcctacgatgtaaaagttgaaggcaaggtataccatgttgaagtagca
gcatcaggggagttatctagtataaccccaggtcagccatctacagcagcgccagcggct
cagccggcatcctcatccagtagtgaaagtgcgcaaagcattaacgcaccgttagccggt
aatgtgttcaaaatactagttcgtgctggcgatgttgtgaatgaaggtgatgtggttatt
attttagaagccatgaaaatggaaactgaaattcgctcagctgtttccggtaccgttagt
gaagtacttgtaggtgaaggcgatgccgtagccagtgctcaaccacttattgcgctgggg
taa

DBGET integrated database retrieval system