KEGG   Alteromonas sp. Mac1: AV939_13525Help
Entry
AV939_13525       CDS       T05687                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ale  Alteromonas sp. Mac1
Pathway
ale00230  Purine metabolism
ale00240  Pyrimidine metabolism
ale01100  Metabolic pathways
ale01110  Biosynthesis of secondary metabolites
ale01130  Biosynthesis of antibiotics
Module
ale_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ale_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ale_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AV939_13525
   00240 Pyrimidine metabolism
    AV939_13525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ale04131]
    AV939_13525
Enzymes [BR:ale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     AV939_13525
Membrane trafficking [BR:ale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    AV939_13525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AMJ87496
Position
complement(3160555..3160986)
Genome map
AA seq 143 aa AA seqDB search
MALERTFSIIKPDAVAKNVIGAIYNRFESAGLRIVASKMIHMSKEQAEGFYAEHKERPFF
GALVDFMTSGPVMVQVLEGENAVVKNREIMGATNPADAAAGTLRSDYAASIDENACHGSD
APESAAREIAYFFSEEEICPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctctagagcgtactttttcgattatcaagcctgatgcggtagctaaaaacgttatc
ggtgcaatttacaaccgtttcgaatctgcaggtcttcgcatcgtggcatctaagatgatc
cacatgagcaaagaacaagctgaaggtttttacgcagaacataaagaacgtccttttttc
ggcgctctagttgatttcatgacatctggcccagttatggttcaggttcttgaaggcgaa
aacgctgttgttaaaaaccgtgaaatcatgggtgcaactaacccagctgatgctgctgct
ggaacacttcgttctgactacgctgcttcaattgatgaaaacgcatgtcacggttctgat
gcaccagaatcagctgcacgtgaaattgcttacttcttctctgaagaagagatttgtcct
cgtacgcgttaa

DBGET integrated database retrieval system