KEGG   Azospirillum lipoferum: AZOLI_0732Help
Entry
AZOLI_0732        CDS       T01658                                 

Definition
(GenBank) Alcohol dehydrogenase (iditol or butanediol)
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ali  Azospirillum lipoferum
Pathway
ali00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AZOLI_0732
Enzymes [BR:ali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AZOLI_0732
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AZOLI_0732
    1.1.1.-  
     AZOLI_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C DAO 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBS86091
UniProt: G7Z9I1
Position
complement(689206..690336)
Genome map
AA seq 376 aa AA seqDB search
MNAITKDPATTMKAAVWHGRKDIRVEDVPLPGAPPAGWVQIKVHWCGICGSDLHEYVAGP
VFIPVDTPHPLTGLKGQCILGHEFSGEIATLGEGVTGFAVGDRVAADACQHCGECYYCKH
GMYNICEKLAFTGLMNNGAFASLVNVPAELLYKLPDGFPTEAGALIEPLAVGMHAVKKAG
SIVGETVVVVGAGTIGLCTIMCAKAAGAGRIIVLEMSAARKAKALEVGASIVLDPKDCDA
VAEVKALTGGYGADVSFECIGHRDTAKLAIDVIRKAGKTVLVGIFEEPSSFNFFEIVATE
KQIIGSLAYNGEFADVIRFIADGRIDVQPLITGRITLDDIVSGGFEELVAHKDRNVKIIV
QPQAVTAAAEQPELVH
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgataaccaaggatccggcgaccacgatgaaggccgccgtctggcatggccgc
aaggacatccgggtcgaggacgtgccgctgccgggcgcgccgcccgcgggatgggtgcag
atcaaggtgcattggtgcggcatctgcgggtccgacctgcacgagtatgtcgccggcccg
gtcttcatccccgtcgacaccccccacccactgaccgggctgaagggccagtgcatcctg
gggcacgagttcagcggcgagatcgcgacgctgggcgagggtgtcaccggcttcgctgtg
ggtgaccgggtggcggccgacgcctgtcagcattgcggcgagtgctattactgcaagcac
ggcatgtacaacatctgcgagaagctggccttcaccggcctgatgaacaacggcgccttc
gccagcctggtcaacgtcccggccgaattgctctacaagctgcccgacggcttcccgacc
gaggccggcgccctgatcgagccgctggcggtcggcatgcatgcggtgaagaaggccggc
agcatcgtcggcgagacggtggtggtggtcggcgccggcaccatcggcctctgcaccatc
atgtgcgcgaaggctgcgggggccgggcggatcatcgtcctggagatgtccgccgcccgc
aaggccaaggcgctggaggtcggcgccagcatcgtgctcgaccccaaggactgcgatgcg
gtggcggaggtgaaggcgctgaccggcggttacggtgccgacgtgtcgttcgaatgcatc
ggccaccgcgacaccgcgaagctcgccatcgacgtgatccgcaaggccggtaagaccgtg
ctggtcggcatcttcgaggagccgagctccttcaacttcttcgagatcgtcgccaccgag
aagcagatcatcggttcgctggcctacaatggcgagttcgccgacgtcatccgcttcatc
gccgacggccgcatcgacgtgcagccgctgatcaccggccgcatcacgctggacgacatc
gtcagcggcggcttcgaggagctggtcgcccacaaggaccgcaacgttaagatcatcgtg
cagccgcaggcggtcaccgcggcggcggaacagccggagctcgtccactga

DBGET integrated database retrieval system