KEGG   Azospirillum lipoferum: AZOLI_1005
Entry
AZOLI_1005        CDS       T01658                                 

Definition
(GenBank) conserved protein of unknown function; putative type VI secretion associated protein, ImpG domain
  KO
K11896  type VI secretion system protein ImpG
Organism
ali  Azospirillum lipoferum
Brite
KEGG Orthology (KO) [BR:ali00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ali02044]
    AZOLI_1005
Secretion system [BR:ali02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZOLI_1005
SSDB
Motif
Pfam: T6SS_TssF DUF2397
Other DBs
NCBI-ProteinID: CBS86339
UniProt: G7Z5W0
Position
complement(935182..937014)
AA seq 610 aa
MADELLPYYNRELTYLRRMAAEFSEAHPKIAGRLRLSADAVEDPHVARLLEGVAFLNARI
SRKLDDEYPELVDTLLDVLYPHYLAPIPSMAVVQMKSSADLTGSHTVPKGTELETEALRG
ETCRFRTVYPATLWPIELDQAVLAGRPLVAPPNPRAGDAVASLRLTLRCRVPEMTFTELA
PDTLRFFLRGQPQQVYALHELLFNNAVSVALADGPQDPNAVILGPDAIRPVGFGDEEGML
PYPARSHRGYRLLTEYFAFPEKFLFFDLHVSPKVLRRAGNTLEIFIYLNSTDGDLERAVS
KDNFALGCTPVVNLFRQRAEPVALTQTQHEHRVVPDARRPGALEVYSVDSVLATDPDGKQ
RRFLPFYGLRHGGVEAVSRTYYTASRRPAGGRDPGTEVHLALVDIDFDPSSPAESVLSVE
TTCLNRDLPGQLPYGGGHPQLKLTEGMAAVAGLSCLTPPTPTLRIAERKGHRWRLVSHLL
LNHLSISGGAEGTEALREILRLYDFRDSAETRGIADGIVKVTTKRGTARAPSRPGDVAWG
DAMCRGIDVGIEFDPQRFSGSGMFLLAMILDHFLGLYCSINSFTRLTATVKGRTGVLRTW
PARAGNRPLL
NT seq 1833 nt   +upstreamnt  +downstreamnt
gtggctgacgaactcctcccatattacaaccgcgagctgacctatctgcgccgcatggcg
gcggagttctcggaggcgcatccgaagatcgccggccgactgcggctcagcgccgacgcg
gtggaggatccgcatgtcgcccggctgctggagggcgtcgccttcctgaatgcccgcatc
agccgcaagctggacgacgagtatccggagctggtcgacacgctgctcgacgtgctctac
ccgcattatctggcgccgatcccgtcgatggcggtggtgcagatgaagagcagcgcggac
ctcaccggctcgcacaccgtgccgaaggggacggagctggagacggaggcgctgcgcggg
gagacctgccgcttccgcaccgtctatcccgcgaccctgtggccgatcgagctggaccag
gcggttctcgccggccgaccgctggtggcgccgcccaacccgcgcgcgggcgacgcggtg
gcctcgctgcgcctgaccctgcgctgccgcgtaccggagatgaccttcacggagctggcg
ccggacaccctgcgcttcttcctgcgcggccaaccgcagcaggtctatgccctgcacgag
ctgctcttcaacaacgccgtctcggtggcgctggccgacggcccgcaggatccgaacgcg
gtgatcctcggccccgacgccatccgcccggtcggcttcggcgacgaggagggcatgctt
ccctaccccgcccgctcccaccgcggctatcggctgctgaccgagtatttcgcctttccg
gagaagttcctgttcttcgaccttcacgtctcgccgaaggtgctgcgccgcgccggcaac
acgctggagatcttcatctatctgaacagcaccgacggcgacctggagcgcgcggtgtcg
aaggacaatttcgcgctgggctgcaccccggtggtcaacctgttccgccagcgggcggag
ccggtcgcgctgacccagacccagcacgaacaccgcgtggttcccgatgcccgccgcccc
ggcgcgctggaggtctattcggtcgacagcgtgctggccaccgatcccgacggcaagcag
cggcgcttcctgcccttctacggcctgcgccacggcggcgtcgaagcggtcagccgcacc
tactacaccgccagccgccgcccggccggcgggcgcgatcccggcaccgaggtgcatctg
gcgctggtcgacatcgacttcgacccgtcgagcccggcggagtccgtcctgtcggtggag
acgacctgcctcaaccgcgacctgccggggcaactgccctatggcggcggccacccgcaa
ctgaagctgacggaggggatggcggcggtcgccggcctgtcctgcctgacgccgccgacg
ccgaccctgcgcatcgccgaacgcaagggccatcgctggcgcctcgtctcccacctgctg
ctgaaccatttgtcgatctccggcggggcggaggggacggaggcgctgcgcgagatcctg
cgcctctacgacttccgcgattcggccgagacccgcggcattgccgacggcatcgtcaag
gtgacgaccaagcgcggcaccgcgcgggcgccgtcccggccgggcgatgtcgcctggggc
gacgccatgtgccgcggcatcgatgtcggcatcgagttcgacccgcagcgcttcagcggc
agcggcatgttcctgctggcgatgatcctcgaccatttcctggggctgtactgctcgatc
aattccttcacgcggctgaccgctacggtcaagggccgcaccggagtgctccgcacatgg
cccgcccgcgccggcaaccgcccgcttctgtaa

DBGET integrated database retrieval system