KEGG   Azospirillum lipoferum: AZOLI_1010Help
Entry
AZOLI_1010        CDS       T01658                                 

Definition
(GenBank) conserved protein of unknown function; putative ImpB domain; type VI secretion associated protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ali  Azospirillum lipoferum
Brite
KEGG Orthology (KO) [BR:ali00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ali02044]
    AZOLI_1010
Secretion system [BR:ali02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZOLI_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA FliT
Motif
Other DBs
NCBI-ProteinID: CBS86344
UniProt: G7Z5W3
Position
complement(941566..942072)
Genome map
AA seq 168 aa AA seqDB search
MASIHQKLDRVRKPRVHITYDVETEGATVVKELPFVVGVLGDFSGDPTEPLKPLKDRKFI
QIDRDNFNDVMARMTPGLKMKVENTLADDGTEMAVELAFKSMEDFEPGRVVQQVEPLRKL
LETRNQLRDLLSKADRSEELEGLLERVLQNTDELKALSGELGTEKKEG
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtatccaccagaagctggatcgcgtgcgcaagccccgcgtccacatcacctac
gacgtcgagaccgagggtgcgaccgtcgtcaaggagctgcccttcgtcgtcggcgtgctc
ggcgacttctcgggcgacccgacggagccgctgaagcccctgaaggaccgcaagttcatc
cagatcgaccgcgacaacttcaacgacgtcatggcccgcatgacgcccggcctgaagatg
aaggtggaaaacaccctggccgacgacggcaccgagatggctgtcgagctcgccttcaag
tcgatggaggatttcgagccgggccgcgtcgtccagcaggtcgagccgctgcgcaagctg
ctggagacccgcaaccagctgcgcgacctgctgagcaaggccgaccgctcggaagagctg
gagggcctgctggagcgcgtgctgcagaacaccgacgagctgaaggcgctgagcggcgag
ctcggcaccgagaagaaggagggttga

DBGET integrated database retrieval system