KEGG   Azospirillum lipoferum: AZOLI_1015Help
Entry
AZOLI_1015        CDS       T01658                                 

Gene name
clpB3
Definition
(GenBank) ATP-dependent chaperone; type VI secretion associated protein
  KO
K11907  type VI secretion system protein VasG
Organism
ali  Azospirillum lipoferum
Pathway
ali03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ali00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZOLI_1015 (clpB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ali02044]
    AZOLI_1015 (clpB3)
Secretion system [BR:ali02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZOLI_1015 (clpB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 Sigma54_activat TniB AAA_22 NACHT Zeta_toxin AAA_25 Hpr_kinase_C ATPase_2 SRP54
Motif
Other DBs
NCBI-ProteinID: CBS86349
UniProt: G7Z4J7
Position
945499..948189
Genome map
AA seq 896 aa AA seqDB search
MVAVDLQSMISRLNPLCRRALEAAAGQTLSRTHYNCEIEHWLLQLIGAADGDISAILRVY
EIDAGRLSADLTRVLDKLKTGNSRAPALSPNLVQLMREAWVLASLQYGEGAVRSGHLLAA
LLSDESLSAQARDMSGQFAKITADVLRRDLPKIVADTAEARTSAPVAAAGGAAGGVAAGG
APKAGGATPNLDQYTIDLTDRAKNGKIDPVLGRDAEIRQIIDVLTRRRQNNPILTGEAGV
GKTAVVEGFALRIAAGDVPPDLRNVRLLSLDLGLLQAGAGMKGEFENRLKGVIDEVKGSS
QPIVMFIDEAHTLIGAGGQAGQNDAANLLKPALARGEMRTVAATTWAEYKKYFEKDPALT
RRFQVVKVEEPAEPVAVDMMRGLTATLEKHHKVRIVTEGLIESVRLSSRYIPARQLPDKA
VSLLDTACARVAMSQTATPPAIEDRRRTIQLTETEVAILEREEAIGIDHAELLAALKDKI
AATQADLEALEARWTKELELVKAINETRDQLVAAHEQSKAPAAEGAPAAEPLDADALNAK
LSALTAELTALQGEDPLVKVAVDGQAVAEVVANWTGVPVGRMVSNEIKTILSLADRMKER
IIGQDHALDAIAQAMWTSRAKLTDPRKPIGVFLMVGTSGVGKTETALTLADLIYGGEQNV
TTINMTEYKEEHKVSLLLGSPPGYVGFGEGGVLTEAVRRRPYSVVLLDELEKAHPGVQDI
FFQVFDKGTIKDGEGRDIDFKNTVIIMTSNAGTDLIHKLCADPETAPDADGLLEALHPEL
QKSFKPAFLGRCTVIPYFQLSDENLAKIVVLQLNRIAKRVVQNYKAAFSYSDDLVQSIVN
RCQEVSSGARNIETILSRTLLPEISSRILARMGDGEPITRIHVSVDGEDRFVYDIA
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggtcgatctgcagagcatgatttcgcggctgaatcctctgtgccggcgggcg
ttggaggctgcggccggacagaccctgtcgcgcacgcattacaattgcgagatcgagcac
tggcttctccagctgatcggcgccgccgacggcgacatctccgccattctgcgcgtctac
gagatcgatgccggccgcctgtccgccgacctgacgcgggtgctggacaagctgaagacc
ggcaacagccgggcgccggccctgtcgcccaatctggtgcagctgatgcgcgaggcgtgg
gtgctggcctcgctgcaatatggcgagggggcggtgcgctccggccatctgctggcggct
ctgctgtccgacgaatcgctgtcggcccaggcgcgcgacatgtccggccagttcgcgaag
atcaccgcggacgtgctgcggcgtgaccttcccaagatcgtcgccgatacggcggaggcg
cgcaccagcgcaccggtcgccgcggcgggcggagcagccggcggggtcgccgcgggcggc
gcgccgaaggccggcggggcgacccccaacctcgaccagtacaccatcgacctgaccgac
cgcgccaagaacggcaagatcgatccggtgctgggccgcgacgccgagatccgccagatc
atcgacgtgctgacccgccgccgccagaacaacccgatcctgaccggcgaagccggtgtc
ggcaagacggcggtggtcgaaggcttcgcgctgcgcatcgccgccggcgacgtgccgccg
gacctgcgcaacgtccgcctgctgtcgctcgacctcggcctgctgcaggccggcgccggc
atgaagggcgagttcgagaaccggctgaagggcgtgatcgacgaggtgaagggctccagc
cagcccatcgtcatgttcatcgacgaggcgcacaccctgatcggcgctggcgggcaggcc
ggccagaacgacgccgccaacctgctgaagccggcgctggcgcgcggcgagatgcgcacc
gtcgccgccaccacctgggccgaatacaagaagtatttcgagaaggacccggcgctgacc
cgccgcttccaggtggtgaaggtggaggagccggcggagccggtcgccgtcgacatgatg
cgcggcctgaccgccacgctggagaagcaccacaaggtccgcatcgtgacggaggggttg
atcgaatcggtccgcctgtccagccgctacatcccggcgcgccagcttcccgacaaggcg
gtcagcctgctggacaccgcctgcgcccgcgtggcgatgagccagaccgcgacgccgccg
gccatcgaggatcgccgccgcaccatccagctgaccgagaccgaggtcgcgatcctggag
cgcgaggaggccatcggcatcgaccatgccgaactgctcgccgcgctgaaggacaagatc
gccgccacccaggccgaccttgaggcgctggaggcgcgctggaccaaggaactggagctg
gtcaaggcgatcaacgagacgcgcgaccagctggtcgccgcgcatgagcagtccaaggcc
ccggctgcggagggggctcctgccgccgagccgctcgacgcggatgcgctgaacgccaag
ctgtcggcgctgaccgccgagctgaccgctctgcagggcgaggatccgctggtcaaggtc
gcggtggacgggcaggcggtggccgaagtggtcgccaactggaccggcgttccggtcggc
cgcatggtctccaacgagatcaagaccatcctgtcgctcgccgaccgcatgaaggagcgg
atcatcggccaggaccacgcgctggacgccatcgcccaggcgatgtggaccagccgggcc
aagctgaccgacccgcgcaagccgatcggcgtcttcctgatggtcggcacgtcgggcgtc
ggcaagaccgagacggcgctgacgctcgccgacctgatctatggcggtgagcagaacgtc
accaccatcaacatgaccgagtacaaggaggagcataaggtctccctgctgctcggatct
cctcccggctatgtcggcttcggcgagggcggcgtcctgaccgaggcggtgcgccgccgg
ccctacagcgtcgtcctgctggacgagctggagaaggcccatcccggcgtgcaggacatc
ttcttccaggtgttcgacaagggcacgatcaaggacggcgaaggccgtgacatcgacttc
aagaacaccgtcatcatcatgacgtcgaatgccggcacggacctgatccacaagctgtgc
gccgacccggagacggcgcccgacgccgatggcctgctggaggccctgcatcccgaactg
cagaagagcttcaagccggccttcctcggccgctgcacggtcatcccctacttccagttg
tcggacgagaatctggcgaagatcgttgtcctgcagttgaaccgcatcgccaagcgggtg
gtgcagaactacaaggccgccttctcctactccgacgatctggtccagagcatcgtcaac
cggtgccaggaggtgtcgagcggcgcccgcaacatcgagacgatcctgagccgcacgctt
ctgccggagatctcgtcccgcatcctcgcccgcatgggcgacggcgagccgatcacccgc
atccacgtctcggtcgatggcgaagaccgcttcgtctacgacatcgcctga

DBGET integrated database retrieval system